Overview

  • Product name

    Anti-WIPF2/WICH antibody
  • Description

    Rabbit polyclonal to WIPF2/WICH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human WIPF2/WICH aa 343-418.
    Sequence:

    PPPYRMHGSEPPSRGKPPPPPSRTPAGPPPPPPPPLRNGHRDSITTVRSF LDDFESKYSFHPVEDFPAPEEYKHFQ


    Database link: Q8TF74

  • Positive control

    • WB: RT4, NIH/3T3 and NBT-II cell lysates. IHC-P: Human cerebral cortex tissue.
  • General notes

     This product was previously labelled as WIPF2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224123 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 46 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    WIPF2 is a WASP interacting protein (WIP)-related protein. It has been shown that WIPF2 has a role in the WASP-mediated organization of the actin cytoskeleton and is a potential link between the activated platelet-derived growth factor receptor and the actin polymerization machinery.
  • Cellular localization

    Cytoplasm; cytoskeleton. Note: Localized to stress fibers and bundles of actin filaments.
  • Database links

  • Alternative names

    • PP10631 antibody
    • WAS/WASL interacting protein family member 2 antibody
    • WASP binding protein antibody
    • WASP interacting protein related protein antibody
    • WICH antibody
    • WIP and CR16 homologous protein antibody
    • WIP related protein antibody
    • WIPF 2 antibody
    • WIPF2_HUMAN antibody
    • WIRE antibody
    see all

Images

  • Paraffin-embedded human cerebral cortex tissue stained for WIPF2/WICH with ab224123 (1/50) in immunohistochemical analysis.

  • Anti-WIPF2/WICH antibody (ab224123) at 1/250 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Predicted band size: 46 kDa

  • All lanes : Anti-WIPF2/WICH antibody (ab224123) at 1/250 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II (rat Wistar bladder tumor cell line) cell lysate

    Predicted band size: 46 kDa

References

ab224123 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224123.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up