Overview

  • Product name

  • Description

    Rabbit polyclonal to WISP3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human WISP3 aa 201-372 (C terminal).
    Sequence:

    PLLQQLSTSYKTMPAYRNLPLIWKKKCLVQATKWTPCSRTCGMGISNRVT NENSNCEMRKEKRLCYIQPCDSNILKTIKIPKGKTCQPTFQLSKAEKFVF SGCSSTQSYKPTFCGICLDKRCCIPNKSKMITIQFDCPNEGSFKWKMLWI TSCVCQRNCREPGDIFSELKIL


    Database link: O95389-2

  • Positive control

    • WB: HepG2 whole cell lysate (ab7900); Mouse heart, brain and kidney lysates; Rat heart and brain lysates. IHC-P: Human liver cancer and kidney tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab224720 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Detects a band of approximately 40 kDa (predicted molecular weight: 40, 42 kDa).

Target

  • Function

    Appears to be required for normal postnatal skeletal growth and cartilage homeostasis.
  • Tissue specificity

    Predominant expression in adult kidney and testis and fetal kidney. Weaker expression found in placenta, ovary, prostate and small intestine. Also expressed in skeletally-derived cells such as synoviocytes and articular cartilage chondrocytes.
  • Involvement in disease

    Defects in WISP3 are the cause of progressive pseudorheumatoid arthropathy of childhood (PPAC) [MIM:208230]. PPAC is an autosomal recessive disorder characterized by stiffness and swelling of joints, motor weakness and joint contractures. Signs and symptoms of the disease develop typically between three and eight years of age. This progressive disease is a primary disorder of articular cartilage with continued cartilage loss and destructive bone changes with aging.
  • Sequence similarities

    Belongs to the CCN family.
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 TSP type-1 domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • CCN 6 antibody
    • CCN family member 6 antibody
    • CCN6 antibody
    • CYR61 antibody
    • LIBC antibody
    • Lost in inflammatory breast cancer tumor suppressor protein antibody
    • MGC125987 antibody
    • MGC125988 antibody
    • MGC125989 antibody
    • OTTHUMP00000040421 antibody
    • PPAC antibody
    • PPD antibody
    • UNQ462/PRO790/PRO956 antibody
    • WISP 3 antibody
    • WISP-3 antibody
    • WISP3 antibody
    • WISP3_HUMAN antibody
    • WNT 1 inducible signaling pathway protein 3 antibody
    • Wnt 1 signaling pathway protein 3 antibody
    • WNT1 inducible signaling pathway protein 3 antibody
    • WNT1 inducible signaling pathway protein 3 precursor antibody
    • WNT1-inducible-signaling pathway protein 3 antibody
    see all

Images

  • All lanes : Anti-WISP3 antibody (ab224720) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 2 : Rat brain lysate
    Lane 3 : Rat heart lysate
    Lane 4 : Mouse heart lysate
    Lane 5 : Mouse brain lysate
    Lane 6 : Mouse kidney lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 40, 42 kDa
    Observed band size: 40 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human kidney tissue stained for WISP3 using ab224720 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver cancer tissue stained for WISP3 using ab224720 at 1/100 dilution in immunohistochemical analysis.

References

This product has been referenced in:

  • Yi Y  et al. WISP3 prevents fibroblast-myofibroblast transdifferentiation in NRK-49F cells. Biomed Pharmacother 99:306-312 (2018). IHC-P . Read more (PubMed: 29353205) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224720.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up