Overview

  • Product name

  • Description

    Rabbit polyclonal to WNK1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human WNK1 aa 1954-2231. Expressed in E. coli. N-terminal tags.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFKVGRFSVSKTEDKI TDTKKEGPVASPPFMDLEQAVLPAVIPKKEKPELSEPSHLNGPSSDPEAA FLSRDVDDGSGSPHSPHQLSSKSLPSQNLSQSLSNSFNSSYMSSDNESDI EDEDLKLELRRLRDKHLKEIQDLQSRQKHEIESLYTKLGKVPPAVIIPPA APLSGRRRRPTKSKGSKSSRSSSLGNKSPQLSGNLSGQSAASVLHPQQTL HPPGNIPESGQNQLLQPLKPSPSSDNLYSAFTSDGAISVPSLSAPGQGTS STNTVGATVNSQAA


    Database link: Q9H4A3

  • Positive control

    • WB: Recombinant human WNK1 protein. HEK-293T cell lysate. Pig liver and kidney tissue lysate. IHC-P: Human testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233266 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Serine/threonine kinase which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival, and proliferation. Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. Activates SCNN1A, SCNN1B, SCNN1D and SGK1. Controls sodium and chloride ion transport by inhibiting the activity of WNK4, by either phosphorylating the kinase or via an interaction between WNK4 and the autoinhibitory domain of WNK1. WNK4 regulates the activity of the thiazide-sensitive Na-Cl cotransporter, SLC12A3, by phosphorylation. WNK1 may also play a role in actin cytoskeletal reorganization. Phosphorylates NEDD4L. Acts as a scaffold to inhibit SLC4A4, SLC26A6 as well as CFTR activities and surface expression, recruits STK39 which mediates the inhibition.
  • Tissue specificity

    Widely expressed, with highest levels observed in the testis, heart, kidney and skeletal muscle. Isoform 3 is kidney-specific and specifically expressed in the distal convoluted tubule (DCT) and connecting tubule (CNT) of the nephron.
  • Involvement in disease

    Pseudohypoaldosteronism 2C
    Neuropathy, hereditary sensory and autonomic, 2A
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. WNK subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    O-glycosylated.
    Ubiquitinated in vitro by the BCR(KLHL3) complex and in vivo by a BCR(KLHL2) complex, leading to proteasomal degradation.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Erythrocyte 65 kDa protein antibody
    • HSAN2 antibody
    • HSN2 antibody
    • hWNK1 antibody
    • KDP antibody
    • KIAA0344 antibody
    • Kinase deficient protein antibody
    • MGC163339 antibody
    • MGC163341 antibody
    • p65 antibody
    • PPP1R167 antibody
    • PRKWNK1 antibody
    • Prostate derived sterile 20 like kinase antibody
    • Protein kinase lysine deficient 1 antibody
    • Protein kinase lysine-deficient 1 antibody
    • Protein kinase with no lysine 1 antibody
    • Protein phosphatase 1, regulatory subunit 167 antibody
    • PSK antibody
    • Serine/threonine protein kinase WNK1 1 antibody
    • Serine/threonine protein kinase WNK1 2 antibody
    • Serine/threonine protein kinase WNK1 antibody
    • Serine/threonine-protein kinase WNK1 antibody
    • With no K antibody
    • WNK lysine deficient protein kinase 1 antibody
    • WNK lysine deficient protein kinase 1 isoform antibody
    • WNK1 antibody
    • WNK1_HUMAN antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human testis tissue stained for WNK1 with ab233266 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-WNK1 antibody (ab233266) at 2 µg/ml

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : Pig liver tissue lysate
    Lane 3 : Pig kidney tissue lysate

    Secondary
    All lanes : HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Anti-WNK1 antibody (ab233266) at 2 µg/ml + Recombinant human WNK1 protein

References

ab233266 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233266.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up