Overview

  • Product name

  • Description

    Rabbit polyclonal to Wnt3a
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Cow
    Predicted to work with: Mouse, Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Cow Wnt3a aa 19-355. (NM_001206024.1; Expressed in E.coli).
    Sequence:

    VLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCRNYIEIMPS VAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAI ASAGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLV SREFADARENRPDARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVK TCWWAQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRAKYALFKP PTERDLVYYENSPNFCEPNPETGSFGTRDRTCNVTSHGIDGCDLLCCGRG HNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK

  • Positive control

    • WB: Cow small intestine lysate; Recombinant cow Wnt3a protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231178 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231178 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 40 kDa.

Target

  • Function

    Ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.
  • Tissue specificity

    Moderately expressed in placenta and at low levels in adult lung, spleen, and prostate.
  • Sequence similarities

    Belongs to the Wnt family.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Protein Wnt 3a Precursor antibody
    • Protein Wnt-3a antibody
    • Wingless type MMTV integration site family member 3A antibody
    • Wnt 3a antibody
    • wnt3a antibody
    • WNT3A protein antibody
    • WNT3A_HUMAN antibody
    see all

Images

  • Anti-Wnt3a antibody (ab231178) at 2 µg/ml + Recombinant cow Wnt3a protein

    Predicted band size: 40 kDa

  • Anti-Wnt3a antibody (ab231178) at 2 µg/ml + Cow small intestine lysate

    Predicted band size: 40 kDa

References

ab231178 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231178.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up