Overview

  • Product name

  • Description

    Rabbit polyclonal to Wnt3a
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human Wnt3a aa 19-352. (Expressed in E.coli).
    Sequence:

    SYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAE GIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASA GVAFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSRE FADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCW WSQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTE RDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNA RAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK


    Database link: P56704

  • Positive control

    • IHC-P: Human liver, skin cancer and breast cancer tissues. WB: MCF7 cell lysate; Recombinant human Wnt3a protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab233485 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233485 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 39 kDa.

Target

  • Function

    Ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.
  • Tissue specificity

    Moderately expressed in placenta and at low levels in adult lung, spleen, and prostate.
  • Sequence similarities

    Belongs to the Wnt family.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Protein Wnt 3a Precursor antibody
    • Protein Wnt-3a antibody
    • Wingless type MMTV integration site family member 3A antibody
    • Wnt 3a antibody
    • wnt3a antibody
    • WNT3A protein antibody
    • WNT3A_HUMAN antibody
    see all

Images

  • Paraffin-embedded human liver tissue stained for Wnt3a using ab233485 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human skin cancer tissue stained for Wnt3a using ab233485 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human breast cancer tissue stained for Wnt3a using ab233485 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Wnt3a antibody (ab233485) at 2 µg/ml + Recombinant human Wnt3a protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 39 kDa

  • Anti-Wnt3a antibody (ab233485) at 2 µg/ml + MCF7 (human breast adenocarcinoma cell line) cell lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 39 kDa

References

ab233485 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233485.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up