For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    wnt5a-antibody-ab229200.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurology process Neural Signal Transduction
Share by email

Anti-Wnt5a antibody (ab229200)

  • Datasheet
  • SDS
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Wnt5a antibody (ab229200)
  • Western blot - Anti-Wnt5a antibody (ab229200)
  • Immunohistochemistry (Frozen sections) - Anti-Wnt5a antibody (ab229200)
  • Western blot - Anti-Wnt5a antibody (ab229200)

Key features and details

  • Rabbit polyclonal to Wnt5a
  • Suitable for: IHC-P, IHC-Fr, WB
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Protein
Product image
Recombinant Human Wnt5a protein (ab204627)
Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-Wnt5a antibody
    See all Wnt5a primary antibodies
  • Description

    Rabbit polyclonal to Wnt5a
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, IHC-Fr, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Xenopus laevis
  • Immunogen

    Synthetic peptide corresponding to Human Wnt5a aa 330-380 conjugated to keyhole limpet haemocyanin.
    Sequence:

    EGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVC K


    Database link: P41221
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: Mouse ovary and uterus tissue lysates. IHC-P: Human lung carcinoma tissue. IHC-Fr: Mouse brain tissue.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol

    Aqueous buffered solution
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Neuroscience
    • Neurology process
    • Neural Signal Transduction
    • Stem Cells
    • Signaling Pathways
    • Wnt
    • Secreted
    • Cancer
    • Oncoproteins/suppressors
    • Tumor suppressors
    • PTC & Wnt pathway

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Recombinant Protein

    • Recombinant Human Wnt5a protein (ab204627)
  • Related Products

    • Recombinant Human Wnt5a protein (ab204627)

Applications

Our Abpromise guarantee covers the use of ab229200 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/400.
IHC-Fr 1/50 - 1/200.
WB 1/100 - 1/1000. Predicted molecular weight: 42 kDa.

Target

  • Function

    Ligand for members of the frizzled family of seven transmembrane receptors. Can activate or inhibit canonical Wnt signaling, depending on receptor context. In the presence of FZD4, activates beta-catenin signaling. In the presence of ROR2, inhibits the canonical Wnt pathway by promoting beta-catenin degradation through a GSK3-independent pathway which involves down-regulation of beta-catenin-induced reporter gene expression. Suppression of the canonical pathway allows chondrogenesis to occur and inhibits tumor formation. Stimulates cell migration. Decreases proliferation, migration, invasiveness and clonogenicity of carcinoma cells and may act as a tumor suppressor. Mediates motility of melanoma cells. Required during embryogenesis for extension of the primary anterior-posterior axis and for outgrowth of limbs and the genital tubercle. Inhibits type II collagen expression in chondrocytes.
  • Tissue specificity

    Expression is increased in differentiated thyroid carcinomas compared to normal thyroid tissue and anaplastic thyroid tumors where expression is low or undetectable. Expression is found in thyrocytes but not in stromal cells (at protein level).
  • Sequence similarities

    Belongs to the Wnt family.
  • Post-translational
    modifications

    Palmitoylation is necessary for stimulation of cell migration, inhibition of the beta-catenin pathway and receptor binding.
    Glycosylation is necessary for secretion but not for activity.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Target information above from: UniProt accession P41221 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 7474 Human
    • Entrez Gene: 22418 Mouse
    • Entrez Gene: 100009381 Rabbit
    • Entrez Gene: 64566 Rat
    • Entrez Gene: 378689 Xenopus laevis
    • Omim: 164975 Human
    • SwissProt: P41221 Human
    • SwissProt: P22725 Mouse
    • SwissProt: Q9QXQ7 Rat
    • SwissProt: P31286 Xenopus laevis
    • Unigene: 643085 Human
    • Unigene: 287544 Mouse
    • Unigene: 48749 Rat
    • Unigene: 19997 Xenopus laevis
    • Unigene: 868 Xenopus laevis
    see all
  • Alternative names

    • hWNT 5A antibody
    • hWNT5A antibody
    • Protein Wnt 5a antibody
    • Protein Wnt-5a antibody
    • Protein Wnt5a antibody
    • Wingless type MMTV integration site family member 5A antibody
    • Wnt 5a antibody
    • WNT 5A protein antibody
    • WNT 5A protein precursor antibody
    • WNT5A antibody
    • WNT5A protein precursor antibody
    • WNT5A_HUMAN antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Wnt5a antibody (ab229200)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Wnt5a antibody (ab229200)

    Formalin-fixed, paraffin-embedded human lung carcinoma tissue stained for Wnt5a using ab229200 at 1/200 dilution in immunohistochemical analysis, followed by conjugation to the secondary antibody and DAB staining.

  • Western blot - Anti-Wnt5a antibody (ab229200)
    Western blot - Anti-Wnt5a antibody (ab229200)
    Anti-Wnt5a antibody (ab229200) at 1/300 dilution + Mouse ovary tissue lysate

    Secondary
    Conjugated secondary antibody at 1/10000 dilution

    Predicted band size: 42 kDa

  • Immunohistochemistry (Frozen sections) - Anti-Wnt5a antibody (ab229200)
    Immunohistochemistry (Frozen sections) - Anti-Wnt5a antibody (ab229200)

    Frozen mouse brain tissue stained for Wnt5a using ab229200 at 1/1000 dilution in immunohistochemical analysis, followed by conjugation to the secondary antibody.

  • Western blot - Anti-Wnt5a antibody (ab229200)
    Western blot - Anti-Wnt5a antibody (ab229200)
    Anti-Wnt5a antibody (ab229200) at 1/300 dilution + Mouse uterus tissue lysate

    Secondary
    Conjugated secondary antibody at 1/10000 dilution

    Predicted band size: 42 kDa

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
    • SDS
  • References (1)

    Publishing research using ab229200? Please let us know so that we can cite the reference in this datasheet.

    ab229200 has been referenced in 1 publication.

    • Zheng X  et al. MicroRNA-221 promotes cell proliferation, migration, and differentiation by regulation of ZFPM2 in osteoblasts. Braz J Med Biol Res 51:e7574 (2018). PubMed: 30365725

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab229200.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.