Anti-Wnt5a antibody (ab229200)
Key features and details
- Rabbit polyclonal to Wnt5a
- Suitable for: IHC-P, IHC-Fr, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-Wnt5a antibody
See all Wnt5a primary antibodies -
Description
Rabbit polyclonal to Wnt5a -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, IHC-Fr, WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Rabbit, Xenopus laevis -
Immunogen
Synthetic peptide corresponding to Human Wnt5a aa 330-380 conjugated to keyhole limpet haemocyanin.
Sequence:EGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVC K
Database link: P41221 -
Positive control
- WB: Mouse ovary and uterus tissue lysates. IHC-P: Human lung carcinoma tissue. IHC-Fr: Mouse brain tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 1% BSA, 50% Glycerol
Aqueous buffered solution -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab229200 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/200 - 1/400. | |
IHC-Fr | 1/50 - 1/200. | |
WB | 1/100 - 1/1000. Predicted molecular weight: 42 kDa. |
Target
-
Function
Ligand for members of the frizzled family of seven transmembrane receptors. Can activate or inhibit canonical Wnt signaling, depending on receptor context. In the presence of FZD4, activates beta-catenin signaling. In the presence of ROR2, inhibits the canonical Wnt pathway by promoting beta-catenin degradation through a GSK3-independent pathway which involves down-regulation of beta-catenin-induced reporter gene expression. Suppression of the canonical pathway allows chondrogenesis to occur and inhibits tumor formation. Stimulates cell migration. Decreases proliferation, migration, invasiveness and clonogenicity of carcinoma cells and may act as a tumor suppressor. Mediates motility of melanoma cells. Required during embryogenesis for extension of the primary anterior-posterior axis and for outgrowth of limbs and the genital tubercle. Inhibits type II collagen expression in chondrocytes. -
Tissue specificity
Expression is increased in differentiated thyroid carcinomas compared to normal thyroid tissue and anaplastic thyroid tumors where expression is low or undetectable. Expression is found in thyrocytes but not in stromal cells (at protein level). -
Sequence similarities
Belongs to the Wnt family. -
Post-translational
modificationsPalmitoylation is necessary for stimulation of cell migration, inhibition of the beta-catenin pathway and receptor binding.
Glycosylation is necessary for secretion but not for activity. -
Cellular localization
Secreted > extracellular space > extracellular matrix. - Information by UniProt
-
Database links
- Entrez Gene: 7474 Human
- Entrez Gene: 22418 Mouse
- Entrez Gene: 100009381 Rabbit
- Entrez Gene: 64566 Rat
- Entrez Gene: 378689 Xenopus laevis
- Omim: 164975 Human
- SwissProt: P41221 Human
- SwissProt: P22725 Mouse
see all -
Alternative names
- hWNT 5A antibody
- hWNT5A antibody
- Protein Wnt 5a antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Wnt5a antibody (ab229200)
Formalin-fixed, paraffin-embedded human lung carcinoma tissue stained for Wnt5a using ab229200 at 1/200 dilution in immunohistochemical analysis, followed by conjugation to the secondary antibody and DAB staining.
-
Anti-Wnt5a antibody (ab229200) at 1/300 dilution + Mouse ovary tissue lysate
Secondary
Conjugated secondary antibody at 1/10000 dilution
Predicted band size: 42 kDa -
Frozen mouse brain tissue stained for Wnt5a using ab229200 at 1/1000 dilution in immunohistochemical analysis, followed by conjugation to the secondary antibody.
-
Anti-Wnt5a antibody (ab229200) at 1/300 dilution + Mouse uterus tissue lysate
Secondary
Conjugated secondary antibody at 1/10000 dilution
Predicted band size: 42 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (1)
ab229200 has been referenced in 1 publication.
- Zheng X et al. MicroRNA-221 promotes cell proliferation, migration, and differentiation by regulation of ZFPM2 in osteoblasts. Braz J Med Biol Res 51:e7574 (2018). PubMed: 30365725