Overview

  • Product name

  • Description

    Rabbit polyclonal to Wnt7a
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human Wnt7a aa 230-280 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    DKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCE E


    Database link: O00755

  • Positive control

    • Rat brain and human colon carcinoma lysates. Human kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab217844 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Detects a band of approximately 41 kDa (predicted molecular weight: 41 kDa).
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. Signaling by Wnt-7a allows sexually dimorphic development of the mullerian ducts.
  • Tissue specificity

    Expression is restricted to placenta, kidney, testis, uterus, fetal lung, and fetal and adult brain.
  • Involvement in disease

    Defects in WNT7A are the cause of limb/pelvis-hypoplasia/aplasia syndrome (LPHAS) [MIM:276820]; also known as absence of ulna and fibula with severe limb deficiency. LPHAS is a limb-malformation disorder characterized by various degrees of limb aplasia/hypoplasia and joint dysplasia.
    Defects in WNT7A are a cause of Fuhrmann syndrome (FUHRS) [MIM:228930]; also known as fibular aplasia or hypoplasia femoral bowing and poly- syn- and oligodactyly. Fuhrmann syndrome is a distinct limb-malformation disorder characterized also by various degrees of limb aplasia/hypoplasia and joint dysplasia.
  • Sequence similarities

    Belongs to the Wnt family.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Protein Wnt-7a antibody
    • Protein Wnt-7a precursor antibody
    • Proto oncogene Wnt7a protein antibody
    • proto-oncogene wnt7a protein antibody
    • wingless-type MMTV integration site family, member 7A antibody
    • Wnt family member 7A antibody
    • WNT7A antibody
    • WNT7A_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human kidney tissue, labeling Wnt7a using ab217844 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • All lanes : Anti-Wnt7a antibody (ab217844) at 1/200 dilution

    Lane 1 : rat brain lysates
    Lane 2 : human colon carcinoma lysates

    Secondary
    All lanes : goat anti-rabbit IgG antibody (H+L) HRP-conjugated at 1/3000 dilution

    Developed using the ECL technique.

    Predicted band size: 41 kDa
    Observed band size: 41 kDa

References

This product has been referenced in:

  • Wu DJ  et al. High expression of WNT7A predicts poor prognosis and promote tumor metastasis in pancreatic ductal adenocarcinoma. Sci Rep 8:15792 (2018). Read more (PubMed: 30361522) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217844.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up