Anti-Wnt9a antibody (ab176973)
Key features and details
- Rabbit polyclonal to Wnt9a
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-Wnt9a antibody
See all Wnt9a primary antibodies -
Description
Rabbit polyclonal to Wnt9a -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment corresponding to Human Wnt9a aa 152-348. (BC113431).
Sequence:DEAPDLENREAWQWGGCGDNLKYSSKFVKEFLGRRSSKDLRARVDFHNNL VGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKHKYETAL KVGSTTNEAAGEAGAISPPRGRASGAGGSDPLPRTPELVHLDDSPSFCLA GRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCY
Database link: O14904 -
Positive control
- PANC-1 cell lysate; mouse heart and Human fetal brain lysates; Human fetal colon tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Lyophilized:Reconstitute in 200 µl of steriled distilled water. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab176973 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/200 - 1/1000. Predicted molecular weight: 40 kDa.
|
|
IHC-P |
1/100 - 1/500.
|
Notes |
---|
WB
1/200 - 1/1000. Predicted molecular weight: 40 kDa. |
IHC-P
1/100 - 1/500. |
Target
-
Function
Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. -
Sequence similarities
Belongs to the Wnt family. -
Cellular localization
Secreted > extracellular space > extracellular matrix. - Information by UniProt
-
Database links
- Entrez Gene: 7483 Human
- Entrez Gene: 216795 Mouse
- Omim: 602863 Human
- SwissProt: O14904 Human
- SwissProt: Q8R5M2 Mouse
- Unigene: 149504 Human
- Unigene: 218794 Mouse
-
Form
Wnt9a is expressed in gastric cancer cell lines. The protein encoding this gene shows 75% amino acid identity to chicken Wnt14, which has been shown to play a central role in initiating synovial joint formation in the chick limb. This gene is clustered with another family member, WNT3A, in the chromosome 1q42 region. -
Alternative names
- MGC138165 antibody
- MGC141991 antibody
- Protein Wnt-14 antibody
see all
Images
-
All lanes : Anti-Wnt9a antibody (ab176973) at 1/500 dilution
Lane 1 : Human fetal brain lysate
Lane 2 : PANC-1 cell lysate
Lane 3 : Mouse heart lysate
Predicted band size: 40 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Wnt9a antibody (ab176973)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal colon tissue labeling Wnt9a with ab176973 at 1/100 dilution.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab176973 has not yet been referenced specifically in any publications.