For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    wnt9a-antibody-ab176973.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Stem Cells Signaling Pathways Wnt Secreted
Share by email

Anti-Wnt9a antibody (ab176973)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-Wnt9a antibody (ab176973)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Wnt9a antibody (ab176973)

Key features and details

  • Rabbit polyclonal to Wnt9a
  • Suitable for: WB, IHC-P
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Protein
Product image
Recombinant Human Wnt9a protein (ab159814)
Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-Wnt9a antibody
    See all Wnt9a primary antibodies
  • Description

    Rabbit polyclonal to Wnt9a
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Wnt9a aa 152-348. (BC113431).
    Sequence:

    DEAPDLENREAWQWGGCGDNLKYSSKFVKEFLGRRSSKDLRARVDFHNNL VGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKHKYETAL KVGSTTNEAAGEAGAISPPRGRASGAGGSDPLPRTPELVHLDDSPSFCLA GRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCY


    Database link: O14904
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • PANC-1 cell lysate; mouse heart and Human fetal brain lysates; Human fetal colon tissue.
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Lyophilized:Reconstitute in 200 µl of steriled distilled water.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Stem Cells
    • Signaling Pathways
    • Wnt
    • Secreted
    • Cancer
    • Oncoproteins/suppressors
    • Tumor suppressors
    • PTC & Wnt pathway

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Positive Controls

    • Mouse heart normal tissue lysate - total protein (ab30291)
  • Recombinant Protein

    • Recombinant Human Wnt9a protein (ab159814)
  • Related Products

    • Recombinant Human Wnt9a protein (ab159814)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab176973 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
1/200 - 1/1000. Predicted molecular weight: 40 kDa.
IHC-P
1/100 - 1/500.
Notes
WB
1/200 - 1/1000. Predicted molecular weight: 40 kDa.
IHC-P
1/100 - 1/500.

Target

  • Function

    Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters.
  • Sequence similarities

    Belongs to the Wnt family.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Target information above from: UniProt accession O14904 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 7483 Human
    • Entrez Gene: 216795 Mouse
    • Omim: 602863 Human
    • SwissProt: O14904 Human
    • SwissProt: Q8R5M2 Mouse
    • Unigene: 149504 Human
    • Unigene: 218794 Mouse
    • Form

      Wnt9a is expressed in gastric cancer cell lines. The protein encoding this gene shows 75% amino acid identity to chicken Wnt14, which has been shown to play a central role in initiating synovial joint formation in the chick limb. This gene is clustered with another family member, WNT3A, in the chromosome 1q42 region.
    • Alternative names

      • MGC138165 antibody
      • MGC141991 antibody
      • Protein Wnt-14 antibody
      • Protein Wnt-9a antibody
      • RP23-378H5.1 antibody
      • Wingless related MMTV integration site 9A antibody
      • Wingless type MMTV integration site 9A antibody
      • Wingless type MMTV integration site family, member 9A antibody
      • wingless-type MMTV integration site family, member 14 antibody
      • Wnt 14 antibody
      • Wnt 9a antibody
      • WNT14 antibody
      • WNT9A antibody
      • WNT9A_HUMAN antibody
      see all

    Images

    • Western blot - Anti-Wnt9a antibody (ab176973)
      Western blot - Anti-Wnt9a antibody (ab176973)
      All lanes : Anti-Wnt9a antibody (ab176973) at 1/500 dilution

      Lane 1 : Human fetal brain lysate
      Lane 2 : PANC-1 cell lysate
      Lane 3 : Mouse heart lysate

      Predicted band size: 40 kDa

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Wnt9a antibody (ab176973)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Wnt9a antibody (ab176973)

      Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal colon tissue labeling Wnt9a with ab176973 at 1/100 dilution.

    Protocols

    • Western blot protocols
    • Immunohistochemistry protocols

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (0)

    Publishing research using ab176973? Please let us know so that we can cite the reference in this datasheet.

    ab176973 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab176973.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.