Anti-WSB1 antibody (ab235090)
Key features and details
- Rabbit polyclonal to WSB1
- Suitable for: IHC-P, WB
- Reacts with: Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-WSB1 antibody
See all WSB1 primary antibodies -
Description
Rabbit polyclonal to WSB1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Rat, Human
Predicted to work with: Mouse -
Immunogen
Recombinant fragment corresponding to Human WSB1 aa 201-421.
Sequence:KDDGNMMKVLRGHQNWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIR KLEGHHHDVVACDFSPDGALLATASYDTRVYIWDPHNGDILMEFGHLFPP PTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRIDEDYPVQVAP LSNGLCCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHLCRMSIRRVMP TQEVQELPIPSKLLEFLSYRI
Database link: Q9Y6I7 -
Positive control
- WB: Rat heart tissue lysate. IHC-P: Human appendix and kidney tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab235090 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. | |
WB | 1/500 - 1/5000. Predicted molecular weight: 47 kDa. |
Target
-
Relevance
WSB1 is a member of the WD-protein subfamily. It shares a high sequence identity to mouse and chick proteins. It contains six WD-repeats spanning most of the protein and an SOCS box in the C-terminus. It is a probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. It recognizes type II iodothyronine deiodinase/DIO2. There are two named isoforms. -
Cellular localization
Intracellular -
Database links
- Entrez Gene: 26118 Human
- Entrez Gene: 78889 Mouse
- Entrez Gene: 303336 Rat
- Omim: 610091 Human
- SwissProt: Q9Y6I7 Human
- SwissProt: O54927 Mouse
-
Alternative names
- SOCS box containing WD protein SWiP 1 antibody
- SWIP1 antibody
- WD repeat and SOCS box containing 1 antibody
see all
Images
-
Anti-WSB1 antibody (ab235090) at 1/500 dilution + Rat brain tissue lysate
Secondary
Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 47 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-WSB1 antibody (ab235090)
Paraffin-embedded human appendix tissue stained for WSB1 using ab235090 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-WSB1 antibody (ab235090)
Paraffin-embedded human kidney tissue stained for WSB1 using ab235090 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab235090 has not yet been referenced specifically in any publications.