Overview

  • Product name

  • Description

    Rabbit polyclonal to WWOX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide within Human WWOX aa 1-50 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTG


    Database link: Q9NZC7

  • Positive control

    • Human gastric carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab216660 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/500.

Target

  • Function

    Putative oxidoreductase. Acts as a tumor suppressor and plays a role in apoptosis. Required for normal bone development (By similarity). May function synergistically with p53/TP53 to control genotoxic stress-induced cell death. Plays a role in TGFB1 signaling and TGFB1-mediated cell death. May also play a role in tumor necrosis factor (TNF)-mediated cell death. Inhibits Wnt signaling, probably by sequestering DVL2 in the cytoplasm.
  • Tissue specificity

    Widely expressed. Strongly expressed in testis, prostate, and ovary. Overexpressed in cancer cell lines. Isoform 5 and isoform 6 may only be expressed in tumor cell lines.
  • Involvement in disease

    Note=Defects in WWOX may be involved in several cancer types. The gene spans the second most common chromosomal fragile site (FRA16D) which is frequently altered in cancers. Alteration of the expression and expression of some isoforms is associated with cancers. However, it is still unclear if alteration of WWOX is directly implicated in cancerogenesis or if it corresponds to a secondary effect.
    Defects in WWOX may be a cause of esophageal cancer (ESCR) [MIM:133239].
  • Sequence similarities

    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
    Contains 2 WW domains.
  • Domain

    The WW 1 domain mediates interaction with TP53, and probably TP73, TFAP2C, LITAF and WBP1.
  • Post-translational
    modifications

    Phosphorylated upon genotoxic stress. Phosphorylation of Tyr-33 regulates interaction with TP53, TP73 and MAPK8. May also regulate proapoptotic activity. Phosphorylation by TNK2 is associated with polyubiquitination and degradation.
    Ubiquitinated when phosphorylated by TNK2, leading to its degradation.
  • Cellular localization

    Cytoplasm. Nucleus. Mitochondrion. Golgi apparatus. Partially localizes to the mitochondria. Translocates to the nucleus upon genotoxic stress or TNF stimulation (By similarity). Translocates to the nucleus in response to TGFB1. Isoform 5 and isoform 6 may localize in the nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5330426P09Rik antibody
    • 9030416C10Rik antibody
    • Aberrant WW domain-containing oxidoreductase antibody
    • D16S432E antibody
    • EC 1.1.1.- antibody
    • EIEE28 antibody
    • FOR antibody
    • FRA16D antibody
    • Fragile site FRA16D oxidoreductase antibody
    • Fragile site FRA16D Oxireductase antibody
    • HHCMA56 antibody
    • MGC55975 antibody
    • PRO0128 antibody
    • Putative oxidoreductase antibody
    • SCAR12 antibody
    • SDR41C1 antibody
    • Short chain dehydrogenase/reductase family 41C, member 1 antibody
    • WOX1 antibody
    • WW domain containing oxidoreductase antibody
    • WW domain-containing oxidoreductase antibody
    • WW domain-containing protein WWOX antibody
    • wwox antibody
    • WWOX_HUMAN antibody
    • zgc:55975 antibody
    see all

Images

  • Anti-WWOX antibody (ab216660) at 1/500 dilution + Mouse cerebrum lysates

    Secondary
    Conjugated secondary antibody at 1/10000 dilution
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human gastric carcinoma tissue labeling WWOX with ab216660 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab216660 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216660.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up