Overview

  • Product name

    Anti-Xanthine Oxidase antibody
    See all Xanthine Oxidase primary antibodies
  • Description

    Rabbit polyclonal to Xanthine Oxidase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Cow, Human
    Predicted to work with: Rat, Cat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Cow Xanthine Oxidase aa 2-219. Expressed in E.coli. N-terminal tags.
    Sequence:

    TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGAC TVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPV QERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCT GYRPILQGFRTFAKNGGCCGGNGNNPNCCMNQKKDHTVTLSPSLFNPEEF MPLDPTQEPIFPPELLRL


    Database link: P80457

  • Positive control

    • WB: Cow and mouse liver lysates; Recombinant cow Xanthine Oxidase protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231316 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 mg/ml. Predicted molecular weight: 147 kDa.

Target

  • Function

    Key enzyme in purine degradation. Catalyzes the oxidation of hypoxanthine to xanthine. Catalyzes the oxidation of xanthine to uric acid. Contributes to the generation of reactive oxygen species. Has also low oxidase activity towards aldehydes (in vitro).
  • Tissue specificity

    Detected in milk (at protein level).
  • Involvement in disease

    Defects in XDH are the cause of xanthinuria type 1 (XU1) [MIM:278300]. Xanthinuria is characterized by excretion of very large amounts of xanthine in the urine and a tendency to form xanthine stones. Uric acid is strikingly diminished in serum and urine. XU1 is due to isolated xanthine dehydrogenase. XU1 patients can metabolize allopurinol.
  • Sequence similarities

    Belongs to the xanthine dehydrogenase family.
    Contains 1 2Fe-2S ferredoxin-type domain.
    Contains 1 FAD-binding PCMH-type domain.
  • Post-translational
    modifications

    Subject to partial proteolysis; this alters the enzyme from the dehydrogenase form (D) to the oxidase form (O).
    Contains sulfhydryl groups that are easily oxidized (in vitro); this alters the enzyme from the dehydrogenase form (D) to the oxidase form (O).
  • Cellular localization

    Cytoplasm. Peroxisome. Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Xanthine dehydrogenase antibody
    • Xanthine dehydrogenase/oxidase antibody
    • Xanthine oxidase antibody
    • Xanthine oxidoreductase antibody
    • XD antibody
    • XDH antibody
    • XDH_HUMAN antibody
    • xdha antibody
    • XO antibody
    • xor antibody
    see all

Images

  • Anti-Xanthine Oxidase antibody (ab231316) at 1 µg/ml + Mouse liver lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit antibody at 1/1000 dilution

    Predicted band size: 147 kDa

  • Anti-Xanthine Oxidase antibody (ab231316) at 2 µg/ml + Recombinant cow Xanthine Oxidase protein

    Predicted band size: 147 kDa

  • Anti-Xanthine Oxidase antibody (ab231316) at 2 µg/ml + Cow liver lysate

    Predicted band size: 147 kDa

References

ab231316 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231316.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up