Overview

  • Product name

  • Description

    Rabbit polyclonal to XIAP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human XIAP aa 1-497. Expressed in E.coli.
    Sequence:

    MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARA GFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLEN SATQSTNSGIQNGQYKVENYLGSRDHFALDRPSETHADYLLRTGQVVDIS DTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQC FCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSESDAVSSDRNF PNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEE CLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQIS GSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKLC KICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS


    Database link: P98170

  • Positive control

    • WB: Recombinant human XIAP; HepG2 and HEK-293T whole cell lysate; human heart and liver tissue lysate. IHC-P: Human kidney tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab233164 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 57 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Apoptotic suppressor. Has E3 ubiquitin-protein ligase activity. Mediates the proteasomal degradation of target proteins, such as caspase-3, SMAC or AIFM1. Inhibitor of caspase-3, -7 and -9. Mediates activation of MAP3K7/TAK1, leading to the activation of NF-kappa-B.
  • Tissue specificity

    Ubiquitous, except peripheral blood leukocytes.
  • Involvement in disease

    Defects in XIAP are the cause of lymphoproliferative syndrome X-linked type 2 (XLP2) [MIM:300635]. XLP is a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus (EBV). Symptoms include severe or fatal mononucleosis, acquired hypogammaglobulinemia, pancytopenia and malignant lymphoma.
  • Sequence similarities

    Belongs to the IAP family.
    Contains 3 BIR repeats.
    Contains 1 RING-type zinc finger.
  • Domain

    The first BIR domain is involved in interaction with TAB1/MAP3K7IP1 and is important for dimerization. The second BIR domain is sufficient to inhibit caspase-3 and caspase-7, while the third BIR is involved in caspase-9 inhibition. The interactions with SMAC and PRSS25 are mediated by the second and third BIR domains.
  • Post-translational
    modifications

    Ubiquitinated and degraded by the proteasome in apoptotic cells.
    Phosphorylation by PKB/AKT protects XIAP against ubiquitination and protects the protein against proteasomal degradation.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • AP 13 antibody
    • API3 antibody
    • Apoptosis Inhibitor 3 antibody
    • Baculoviral IAP repeat containing 4 antibody
    • Baculoviral IAP Repeat Containing Protein 4 antibody
    • Baculoviral IAP repeat-containing protein 4 antibody
    • BIRC 4 antibody
    • BIRC4 antibody
    • E3 ubiquitin-protein ligase XIAP antibody
    • hIAP-3 antibody
    • hIAP3 antibody
    • HILP antibody
    • IAP 3 antibody
    • IAP like protein antibody
    • IAP-3 antibody
    • IAP-like protein antibody
    • IAP3 antibody
    • ILP 1 antibody
    • ILP antibody
    • ILP1 antibody
    • Inhibitor of apoptosis protein 3 antibody
    • Inhibitor of Apoptosis X Linked antibody
    • Mammalian IAP Homologue A antibody
    • MIHA antibody
    • X linked IAP antibody
    • X linked inhibitor of apoptosis antibody
    • X linked inhibitor of apoptosis E3 ubiquitin protein ligase antibody
    • X linked inhibitor of apoptosis protein antibody
    • X-linked IAP antibody
    • X-linked inhibitor of apoptosis protein antibody
    • Xiap antibody
    • XIAP_HUMAN antibody
    • XLP2 antibody
    see all

Images

  • Anti-XIAP antibody (ab233164) at 1 µg/ml + Recombinant human XIAP

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 57 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for XIAP using ab233164 at 20μg/ml in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for XIAP (green) using ab233164 at 20μg/ml in ICC/IF. FITC staining.

  • All lanes : Anti-XIAP antibody (ab233164) at 1 µg/ml

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 3 : Human heart tissue lysate
    Lane 4 : Human liver tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 57 kDa

References

ab233164 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233164.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up