Overview

  • Product name

  • Description

    Rabbit polyclonal to XPG
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Pig
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human XPG aa 778-986. (Expressed in E.coli).
    Sequence:

    LFGIPYIQAPMEAEAQCAILDLTDQTSGTITDDSDIWLFGARHVYRNFFN KNKFVEYYQYVDFHNQLGLDRNKLINLAYLLGSDYTEGIPTVGCVTAMEI LNEFPGHGLEPLLKFSEWWHEAQKNPKIRPNPHDTKVKKKLRTLQLTPGF PNPAVAEAYLKPVVDDSKGSFLWGKPDLDKIREFCQRYFGWNRTKTDESL FPVLKQLDA


    Database link: P28715

  • Positive control

    • WB: Recombinant human XPG protein; Pig liver lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233226 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 1 - 5 µg/ml.

Target

  • Function

    Single-stranded structure-specific DNA endonuclease involved in DNA excision repair. Makes the 3'incision in DNA nucleotide excision repair (NER). Acts as a cofactor for a DNA glycosylase that removes oxidized pyrimidines from DNA. May also be involved in transcription-coupled repair of this kind of damage, in transcription by RNA polymerase II, and perhaps in other processes too.
  • Involvement in disease

    Defects in ERCC5 are the cause of xeroderma pigmentosum complementation group G (XP-G) [MIM:278780]; also known as xeroderma pigmentosum VII (XP7). Xeroderma pigmentosum is an autosomal recessive pigmentary skin disorder characterized by solar hypersensitivity of the skin, high predisposition for developing cancers on areas exposed to sunlight and, in some cases, neurological abnormalities. Some XP-G patients present features of Cockayne syndrome, including dwarfism, sensorineural deafness, microcephaly, mental retardation, pigmentary retinopathy, ataxia, decreased nerve conduction velocities.
  • Sequence similarities

    Belongs to the XPG/RAD2 endonuclease family. XPG subfamily.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • COFS 3 antibody
    • COFS3 antibody
    • DNA excision repair protein ERCC 5 antibody
    • DNA excision repair protein ERCC-5 antibody
    • DNA excision repair protein ERCC5 antibody
    • DNA repair protein complementing XP G cells antibody
    • DNA repair protein complementing XP-G cells antibody
    • DNA repair protein complementing XPG cells antibody
    • ERCC 5 antibody
    • ERCC5 antibody
    • ERCC5_HUMAN antibody
    • ERCM 2 antibody
    • ERCM2 antibody
    • Excision repair cross complementation group 5 antibody
    • Excision Repair Cross Complementing Rodent Repair Deficiency antibody
    • Excision repair cross complementing rodent repair deficiency complementation group 5 antibody
    • Excision repair protein antibody
    • OTTHUMP00000064902 antibody
    • UVDR antibody
    • Xeroderma Pigmentosum Complementation Group G antibody
    • Xeroderma pigmentosum complementation group G protein antibody
    • Xeroderma pigmentosum group G complementing protein antibody
    • Xeroderma pigmentosum group G-complementing protein antibody
    • XPG antibody
    • XPG complementing protein antibody
    • XPGC antibody
    see all

Images

  • Anti-XPG antibody (ab233226) at 2 µg/ml + Recombinant human XPG protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Anti-XPG antibody (ab233226) at 2 µg/ml + Pig liver lysate

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

References

ab233226 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233226.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up