Anti-XPNPEP1 antibody (ab235324)
Key features and details
- Rabbit polyclonal to XPNPEP1
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-XPNPEP1 antibody
See all XPNPEP1 primary antibodies -
Description
Rabbit polyclonal to XPNPEP1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant full length protein corresponding to Human XPNPEP1 aa 2-623.
Sequence:PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRA FVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTP TQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLV DKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTA LDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHL LLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSET IPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKE VPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPE TNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGH IAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGP CGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNF NNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQ KQGRQEALEWLIRETQPISKQH
Database link: Q9NQW7-1 -
Positive control
- WB: Mouse small intestine, stomach and kidney lysates. IHC-P: Human colon cancer tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab235324 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000 - 1/5000. Predicted molecular weight: 70 kDa. | |
IHC-P | 1/20 - 1/200. |
Target
-
Function
Contributes to the degradation of bradykinin. Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro. -
Tissue specificity
Expressed in all tissues tested, including pancreas, heart, muscle, kidney, liver, lung and brain. Highest levels in pancreas. -
Sequence similarities
Belongs to the peptidase M24B family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 7511 Human
- Entrez Gene: 170750 Mouse
- Omim: 602443 Human
- SwissProt: Q9NQW7 Human
- SwissProt: Q6P1B1 Mouse
- Unigene: 390623 Human
- Unigene: 99776 Mouse
-
Form
X-prolyl aminopeptidase is a proline-specific metalloaminopeptidase that specifically catalyzes the removal of any unsubstituted N-terminal amino acid that is adjacent to a penultimate proline residue. There are 2 isoforms produced by alternative splicing. -
Alternative names
- Aminoacylproline aminopeptidase antibody
- aminopeptidase P, cytosolic antibody
- APP1 antibody
see all
Images
-
All lanes : Anti-XPNPEP1 antibody (ab235324) at 1/1000 dilution
Lane 1 : Mouse small intestine lysate
Lane 2 : Mouse stomach lysate
Lane 3 : Mouse kidney lysate
Secondary
All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution
Predicted band size: 70 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-XPNPEP1 antibody (ab235324)
Paraffin-embedded human colon cancer tissue stained for XPNPEP1 using ab235324 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab235324 has not yet been referenced specifically in any publications.