Overview

  • Product name

  • Description

    Rabbit polyclonal to XPNPEP3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human XPNPEP3 aa 53-220.
    Sequence:

    THPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSN PTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILF VPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMV WYDWMRPSHAQLHSDYMQ


    Database link: Q9NQH7

  • Positive control

    • IHC-P: Human stomach tissue. WB: NIH/3T3, NBT-II, PC-12, RT4, EFO-21 and A431 cell lysate. Human liver tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab224211 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 57 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Isoform 1 and isoform 2 are widely expressed, with isoform 1 being more abundant.
  • Involvement in disease

    Defects in XPNPEP3 are the cause of nephronophthisis-like nephropathy type 1 (NPHPL1) [MIM:613159]. A disorder with features of nephronophthisis, a cystic kidney disease leading to end-stage renal failure. Nephronophthisis is histologically characterized by modifications of the tubules with thickening of the basement membrane, interstitial fibrosis and, in the advanced stages, medullary cysts. Typical clinical manifestation are chronic renal failure, anemia, polyuria, polydipsia, isosthenuria, and growth retardation. Associations with extrarenal symptoms are frequent. In NPHPL1 patients, extrarenal symptoms include hypertension, essential tremor, sensorineural hearing loss and gout. Severely affected individuals can manifest a mitochondrial disorder with isolated complex I deficiency activity in muscle, seizures, mental retardation and hypertrophic dilated cardiomyopathy.
  • Sequence similarities

    Belongs to the peptidase M24B family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • Aminopeptidase P3 antibody
    • APP3 antibody
    • NPHPL1 antibody
    • OTTHUMP00000199806 antibody
    • Probable Xaa Pro aminopeptidase 3 antibody
    • Probable Xaa-Pro aminopeptidase 3 antibody
    • X Pro aminopeptidase 3 antibody
    • X prolyl aminopeptidase (aminopeptidase P) 3 antibody
    • X-Pro aminopeptidase 3 antibody
    • XPNPEP3 antibody
    • XPP3_HUMAN antibody
    see all

Images

  • Paraffin embedded human stomach tissue stained for XPNPEP3 with ab224211 (1/200 dilution) in immunohistochemical analysis.

  • All lanes : Anti-XPNPEP3 antibody (ab224211) at 1/250 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : EFO-21 cell lysate
    Lane 3 : A431 (human epidermoid carcinoma cell line) cell lysate
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Predicted band size: 57 kDa

  • All lanes : Anti-XPNPEP3 antibody (ab224211) at 1/250 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate
    Lane 3 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell lysate

    Predicted band size: 57 kDa

References

ab224211 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224211.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up