Anti-XPO6 antibody (ab243712)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-XPO6 antibody
See all XPO6 primary antibodies -
Description
Rabbit polyclonal to XPO6 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse
-
Immunogen
Recombinant fragment corresponding to Human XPO6 aa 929-1016.
Sequence:RPSPDVKAELFELLFRTLHHNWRYFFKSTVLASVQRGIAEEQMENEPQFS AIMQAFGQSFLQPDIHLFKQNLFYLETLNTKQKLYHKK
Database link: Q96QU8 -
Positive control
- IHC-P: Human kidney tissue. ICC/IF: U-2 OS cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab243712 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Mediates the nuclear export of actin and profilin-actin complexes in somatic cells. -
Sequence similarities
Belongs to the exportin family.
Contains 1 importin N-terminal domain. -
Cellular localization
Nucleus. Cytoplasm. Shuttles between the nucleus and the cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 23214 Human
- Entrez Gene: 74204 Mouse
- Omim: 608411 Human
- SwissProt: Q96QU8 Human
- SwissProt: Q924Z6 Mouse
- Unigene: 460468 Human
- Unigene: 235663 Mouse
-
Alternative names
- Exp6 antibody
- Exportin 6 antibody
- Exportin-6 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-XPO6 antibody (ab243712)Formalin-fixed, paraffin-embedded human kidney tissue stained for XPO6 using ab243712 at 1/500 dilution in immunohistochemical analysis.
-
Immunocytochemistry/ Immunofluorescence - Anti-XPO6 antibody (ab243712)PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for XPO6 (green) using ab243712 at 4 µg/ml in ICC/IF.
Datasheets and documents
References
ab243712 has not yet been referenced specifically in any publications.
