Anti-XPO6 antibody (ab243712)
Key features and details
- Rabbit polyclonal to XPO6
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-XPO6 antibody
See all XPO6 primary antibodies -
Description
Rabbit polyclonal to XPO6 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Recombinant fragment corresponding to Human XPO6 aa 929-1016.
Sequence:RPSPDVKAELFELLFRTLHHNWRYFFKSTVLASVQRGIAEEQMENEPQFS AIMQAFGQSFLQPDIHLFKQNLFYLETLNTKQKLYHKK
Database link: Q96QU8 -
Positive control
- IHC-P: Human kidney tissue. ICC/IF: U-2 OS cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab243712 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Mediates the nuclear export of actin and profilin-actin complexes in somatic cells. -
Sequence similarities
Belongs to the exportin family.
Contains 1 importin N-terminal domain. -
Cellular localization
Nucleus. Cytoplasm. Shuttles between the nucleus and the cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 23214 Human
- Entrez Gene: 74204 Mouse
- Omim: 608411 Human
- SwissProt: Q96QU8 Human
- SwissProt: Q924Z6 Mouse
- Unigene: 460468 Human
- Unigene: 235663 Mouse
-
Alternative names
- Exp6 antibody
- Exportin 6 antibody
- Exportin-6 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-XPO6 antibody (ab243712)
Formalin-fixed, paraffin-embedded human kidney tissue stained for XPO6 using ab243712 at 1/500 dilution in immunohistochemical analysis.
-
PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for XPO6 (green) using ab243712 at 4 µg/ml in ICC/IF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243712 has not yet been referenced specifically in any publications.