Overview

  • Product name

    Anti-XRCC3 antibody [OTI5B11]
    See all XRCC3 primary antibodies
  • Description

    Mouse monoclonal [OTI5B11] to XRCC3
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human XRCC3 aa 1-235. Produced in E.coli (NP_005423).
    Sequence:

    MDLDLLDLNPRIIAAIKKAKLKSVKEVLHFSGPDLKRLTNLSSPEVWHLL RTASLHLRGSSILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLD GITELAGRSSAGKTQLALQLCLAVQFPRQHGGLEAGAVYICTEDAFPHKR LQQLMAQQPRLRTDVPGELLQKLRFGSQIFIEHVADVDTLLECVNKKVPV LLSRGMARLVVIDSVAAPFRCEFDSQASAPRARHL


    Database link: O43542

  • Positive control

    • WB: pCMV6-ENTRY XRCC3 cDNA transfected HEK-293T cell lysate.
  • General notes

    Clone OTI5B11 (formerly 5B11).

Properties

Applications

Our Abpromise guarantee covers the use of ab236526 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 37 kDa.

Target

  • Function

    Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA, thought to repair chromosomal fragmentation, translocations and deletions. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51 and RAD51C.
  • Sequence similarities

    Belongs to the RecA family. RAD51 subfamily.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Cytoplasm. Cytoplasm > perinuclear region. Mitochondrion. Accumulates in discrete nuclear foci prior to DNA damage, and these foci persist throughout the time course of DNA repair.
  • Information by UniProt
  • Database links

  • Alternative names

    • CMM6 antibody
    • DNA repair protein XRCC3 antibody
    • RAD51 like antibody
    • X ray repair complementing defective repair in Chinese hamster antibody
    • X ray repair complementing defective repair in Chinese hamster cells 3 antibody
    • X ray repair cross complementing protein 3 antibody
    • X-ray repair cross-complementing protein 3 antibody
    • XRCC 3 antibody
    • XRCC3 antibody
    • XRCC3_HUMAN antibody
    see all

Images

  • All lanes : Anti-XRCC3 antibody [OTI5B11] (ab236526) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY XRCC3 cDNA transfected HEK-293T cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 37 kDa

References

ab236526 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236526.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up