Overview

  • Product name

  • Description

    Rabbit polyclonal to XRCC4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human XRCC4 aa 164-296.
    Sequence:

    KCVSAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNAAQEREKDIKQEG ETAICSEMTADRDPVYDESTDEESENQTDLSGLASAAVSKDDSIISSLDV TDIAPSRKRRQRMQRNLGTEPKMAPQENQLQEK


    Database link: Q13426

  • Positive control

    • Human lymph node tissue; U-251 MG cells; XRCC4 overexpression HEK293T cell lysate with a C-terminal myc-DDK tag (~3.1 kDa).

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab213729 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilisation: PFA/Triton X-100.

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 38 kDa.

Target

  • Function

    Involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination. Binds to DNA and to DNA ligase IV (LIG4). The LIG4-XRCC4 complex is responsible for the NHEJ ligation step, and XRCC4 enhances the joining activity of LIG4. Binding of the LIG4-XRCC4 complex to DNA ends is dependent on the assembly of the DNA-dependent protein kinase complex DNA-PK to these DNA ends.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the XRCC4 family.
  • Post-translational
    modifications

    Phosphorylated by PRKDC. The phosphorylation seems not to be necessary for binding to DNA. Phosphorylation by CK2 promotes interaction with APTX.
    Monoubiquitinated.
    Sumoylation at Lys-210 is required for nuclear localization and recombination efficiency. Has no effect on ubiquitination.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DNA double strand break repair and V(D)J recombination protein XRCC4 antibody
    • DNA repair protein XRCC4 antibody
    • SSMED antibody
    • X ray repair complementing defective repair in Chinese hamster cells 4 antibody
    • X ray repair cross complementing 4 antibody
    • X ray repair cross complementing protein 4 antibody
    • X-ray repair cross-complementing protein 4 antibody
    • XRCC 4 antibody
    • XRCC4 antibody
    • XRCC4_HUMAN antibody
    see all

Images

  • All lanes : Anti-XRCC4 antibody (ab213729)

    Lane 1 : Rh30 cells transfected with control siRNA
    Lanes 2-3 : Rh30 cells transfected with target specific siRNA probe

    Predicted band size: 38 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human lymph node tissue labeling XRCC4 with ab213729 at 1/200 dilution.

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permealised U-251 MG cells labeling XRCC4 with ab213729 at 4 μg/ml (green).

  • All lanes : Anti-XRCC4 antibody (ab213729)

    Lane 1 : U2OS cells transfected with target specific siRNA probe 1
    Lane 2 : U2OS cells transfected with target specific siRNA probe 2
    Lane 3 : U2OS cells transfected with control siRNA

    Predicted band size: 38 kDa

  • All lanes : Anti-XRCC4 antibody (ab213729) at 1/100 dilution

    Lane 1 : Negative control (vector only transfected HEK293T lysate)
    Lane 2 : XRCC4 overexpression HEK293T cell lysate with a C-terminal myc-DDK tag (~3.1 kDa).

    Predicted band size: 38 kDa

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab213729.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up