Overview

  • Product name

    Anti-XRCC6BP1/KUB3 antibody [OTI5F3]
    See all XRCC6BP1/KUB3 primary antibodies
  • Description

    Mouse monoclonal [OTI5F3] to XRCC6BP1/KUB3
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human XRCC6BP1/KUB3 aa 1-246. Produced in E.coli (NP_150592).
    Sequence:

    MAGAPDERRRGPAAGEQLQQQHVSCQVFPERLAQGNPQQGFFSSFFTSNQ KCQLRLLKTLETNPYVKLLLDAMKHSGCAVNKDRHFSCEDCNGNVSGGFD ASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDWFTNIRHLACS EVRAANLSGDCSLVNEIFRLHFGLKQHHQTCVRDRATLSILAVRNISKEV AKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYSNI


    Database link: Q9Y6H3

  • Positive control

    • WB: pCMV6-ENTRY XRCC6BP1/KUB3 transfected HEK-293T cell lysate. IHC-P: Human ovary adenocarcinoma, endometrium adenocarcinoma and bladder tissue.
  • General notes

     This product was previously labelled as XRCC6BP1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI5F3
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236425 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500. Predicted molecular weight: 28 kDa.
IHC-P 1/150.

Perform heat-induced epitope retrieval by 1 mM EDTA in 10 mM Tris buffer (pH 8.5) at 120°C for 3 minutes.

Target

  • Relevance

    XRCC6BP1 may be involved in double-strand break repair via nonhomologous end joining.
  • Database links

  • Alternative names

    • EC 3.4.24 antibody
    • Ku70 binding protein 3 antibody
    • KUB3 antibody
    • MGC134817 antibody
    • MGC134818 antibody
    • Mitochondrial inner membrane protease ATP23 homolog antibody
    • XRCC6 binding protein 1 antibody
    see all

Images

  • All lanes : Anti-XRCC6BP1/KUB3 antibody [OTI5F3] (ab236425) at 1/500 dilution

    Lane 1 : pCMV6-ENTRY control transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY XRCC6BP1/KUB3 transfected HEK-293T cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 28 kDa

  • Paraffin-embedded human ovary adenocarcinoma tissue stained for XRCC6BP1/KUB3 using ab236425 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrium adenocarcinoma tissue stained for XRCC6BP1/KUB3 using ab236425 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human bladder tissue stained for XRCC6BP1/KUB3 using ab236425 at 1/150 dilution in immunohistochemical analysis.

References

ab236425 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236425.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up