Overview

  • Product name

  • Description

    Rabbit polyclonal to Xrn1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat Xrn1 aa 1567-1723. Expressed in E.coli. N-terminal tags.
    Sequence:

    FPQPTANMMPSSSHLFGSVPWRPPVPVPGNAYHYPSYPATMPLAGGMPGG VHNQFIPLQVTKKRVANKKNFENKEAQSSQATPLQTNKPGSSEATRMTPQ EGSPASSASSQATQPVSSHVETASQGHVVSHQRSAPSSSRRKSRKLAVNF SVSKPSE


    Database link: D4ABN8

  • Positive control

    • WB: Recombinant rat Xrn1 protein; MCF7 cell lysate. IHC-P: Rat stomach tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231197 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Relevance

    Xrn1 is the major 5'-3' exoribonuclease involved in mRNA decay. Required for the 5'-3'processing of the G4 tetraplex-containing DNA and RNA substrates. The kinetic of hydrolysis is faster for G4 RNA tetraplex than for G4 DNA tetraplex and monomeric RNA tetraplex. Binds to RNA and DNA (By similarity). May act as a tumor suppressor protein in osteogenic sarcoma (OGS). Associates with alpha and beta tubulins (By similarity). Found in a mRNP complex with RENT1, RENT2, RENT3B and XRN1.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • 5'-3' exoribonuclease 1 antibody
    • Dhm2 antibody
    • mXRN1 antibody
    • SEP1 antibody
    • Strand-exchange protein 1 homolog antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for Xrn1 using ab231197 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Xrn1 antibody (ab231197) at 2 µg/ml + MCF7 (human breast adenocarcinoma cell line) cell lysate
  • Anti-Xrn1 antibody (ab231197) at 2 µg/ml + Recombinant rat Xrn1 protein

References

ab231197 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231197.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up