Overview

  • Product name

    Anti-XTP3TPA antibody
  • Description

    Rabbit polyclonal to XTP3TPA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human XTP3TPA aa 36-164.
    Sequence:

    RLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWS PRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLAR SSSRKYTELPHGAISEDQAVGPADIPCDS


    Database link: Q9H773

  • Positive control

    • IHC: Human uterine corpus tissue. ICC/IF: A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224051 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Hydrolyzes deoxynucleoside triphosphates (dNTPs) to the corresponding nucleoside monophosphates. Has a strong preference for modified dCTP. Activity is highest with 5-iodo-dCTP, followed by 5-bromo-dCTP, unmodified dCTP, 5-methyl-dCTP and 5-chloro-dCTP. Hydrolyzes 2-chloro-dATP and 2-hydroxy-dATP with lower efficiency, and has even lower activity with unmodified dATP, dTTP and dUTP (in vitro). Does not hydrolyze ATP, UTP, ITP, GTP, dADP, dCDP or dGTP. May protect DNA or RNA against the incorporation of non-canonical nucleotide triphosphates. May protect cells against inappropriate methylation of CpG islands by DNA methyltransferases.
  • Sequence similarities

    Contains 1 EAR repeat.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • CDA03 antibody
    • dCTP pyrophosphatase 1 antibody
    • DCTP1_HUMAN antibody
    • dCTPase 1 antibody
    • DCTPP1 antibody
    • Deoxycytidine triphosphatase 1 antibody
    • Deoxycytidine-triphosphatase 1 antibody
    • RS21C6 antibody
    • XTP3 transactivated gene A protein antibody
    • XTP3 transactivated protein A antibody
    • XTP3-transactivated gene A protein antibody
    see all

Images

  • Paraffin-embedded human uterine corpus tissue stained for XTP3TPA using ab224051 at 1/200 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for XTP3TPA (green) using ab224051 at 4 µg/ml in ICC/IF.

References

ab224051 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224051.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up