Overview

  • Product name

  • Description

    Rabbit polyclonal to XYLT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Dog, Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human XYLT1 aa 820-950.
    Sequence:

    VWTVKILHHWVPVAETKFLVAPLTFSNRQPIKPEEALKLHNGPLRNAYME QSFQSLNPVLSLPINPAQVEQARRNAASTGTALEGWLDSLVGGMWTAMDI CATGPTACPVMQTCSQTAWSSFSPDPKSELG


    Database link: Q86Y38

  • Positive control

    • IHC-P: Human skeletal muscle tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224240 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Catalyzes the first step in biosynthesis of glycosaminoglycan. Transfers D-xylose from UDP-D-xylose to specific serine residues of the core protein. Initial enzyme in the biosynthesis of chondroitin sulfate and dermatan sulfate proteoglycans in fibroblasts and chondrocytes.
  • Tissue specificity

    Widely expressed. Expressed at higher level in placenta, kidney and pancreas. Weakly expressed in skeletal muscle.
  • Pathway

    Glycan metabolism; chondroitin sulfate biosynthesis.
    Glycan metabolism; heparan sulfate biosynthesis.
  • Sequence similarities

    Belongs to the glycosyltransferase 14 family. XylT subfamily.
  • Post-translational
    modifications

    Contains 7 disulfide bonds.
    N-glycosylated.
  • Cellular localization

    Endoplasmic reticulum membrane. Golgi apparatus membrane. Secreted. Some fraction is also found in the extracellular space together with chondroitin sulfate proteoglycans, suggesting that it can be secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beta D xylosyltransferase 1 antibody
    • O xylosyltransferase 1 antibody
    • Peptide O-xylosyltransferase 1 antibody
    • PXYLT1 antibody
    • UDP-D-xylose:proteoglycan core protein antibody
    • XT-I antibody
    • XT1 antibody
    • XTI antibody
    • Xylosyltransferase 1 antibody
    • Xylosyltransferase I antibody
    • xylosyltransferase iota antibody
    • XylT-I antibody
    • XYLT1 antibody
    • XYLT1_HUMAN antibody
    see all

Images

  • Paraffin-embedded human skeletal muscle tissue stained for XYLT1 using ab224240 at 1/20 dilution in immunohistochemical analysis.

References

ab224240 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224240.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up