Overview

  • Product name

  • Description

    Rabbit polyclonal to YAF2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human YAF2 aa 1-204.
    Sequence:

    MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTST RSTLFEVIVSASRTKEPLKFPISGRKPRPVSQLVAQQVTQQFVPPTQSKK EKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVI ITDFKEKTKSPPASSAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLN GESH


    Database link: Q8IY57-2

  • Positive control

    • IHC-P: Human colon cancer and glioma tissue.
  • General notes

     This product was previously labelled as YY1 associated factor 2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab239150 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Binds to MYC and inhibits MYC-mediated transactivation. Also binds to MYCN and enhances MYCN-dependent transcriptional activation. Increases calpain 2-mediated proteolysis of YY1 in vitro. Component of the E2F6.com-1 complex, a repressive complex that methylates 'Lys-9' of histone H3, suggesting that it is involved in chromatin-remodeling.
  • Sequence similarities

    Contains 1 RanBP2-type zinc finger.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC41856 antibody
    • YAF2 antibody
    • YAF2_HUMAN antibody
    • YY1-associated factor 2 antibody

Images

  • Paraffin-embedded human colon cancer tissue stained for YAF2 with ab239150 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human glioma tissue stained for YAF2 with ab239150 at a 1/100 dilution in immunohistochemical analysis.

References

ab239150 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239150.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up