Overview

  • Product name

  • Description

    Rabbit polyclonal to YANK2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human YANK2 aa 259-301.
    Sequence:

    LRKLLTKDPESRVSSLHDIQSVPYLADMNWDAVFKKALMPGFV


    Database link: Q9NY57

  • Positive control

    • U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221054 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2510009F08Rik antibody
    • gene for serine/threonine protein kinase antibody
    • HSA250839 antibody
    • PRO9744 antibody
    • Serine/threonine kinase 32B antibody
    • Serine/threonine-protein kinase 32B antibody
    • ST32B_HUMAN antibody
    • STK32 antibody
    • STK32B antibody
    • STKG6 antibody
    • UNQ3003 antibody
    • YANK 2 antibody
    • YANK2 antibody
    • Yet another novel kinase 2 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling YANK2 with ab221054 at 4 μg/ml (green).

References

ab221054 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221054.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up