Overview

  • Product name

    Anti-YBEY antibody
  • Description

    Rabbit polyclonal to YBEY
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human YBEY aa 54-167.
    Sequence:

    YRDRNVPTDVLSFPFHEHLKAGEFPQPDFPDDYNLGDIFLGVEYIFHQCK ENEDYNDVLTVTATHGLCHLLGFTHGTEAEWQQMFQKEKAVLDELGRRTG TRLQPLTRGLFGGS


    Database link: P58557-1

  • Positive control

    • IHC-P: Human colon cancer and tonsil tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238821 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    May have metal-dependent hydrolase activity.
  • Sequence similarities

    Belongs to the rRNA maturation factor YbeY family.
  • Information by UniProt
  • Database links

  • Alternative names

    • C21orf57 antibody
    • Putative metalloprotease C21orf57 antibody
    • rRNA maturation factor homolog antibody
    • ybeY antibody
    • YbeY metallopeptidase antibody
    • YBEY_HUMAN antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for YBEY using ab238821 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human tonsil tissue stained for YBEY using ab238821 at 1/100 dilution in immunohistochemical analysis.

References

ab238821 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238821.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up