Overview

  • Product name

    Anti-YIF1A antibody - N-terminal
    See all YIF1A primary antibodies
  • Description

    Rabbit polyclonal to YIF1A - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide derived from a region within N terminal amino acids 25-74 (

    LFDDTSGGYSSQPGGYPATGADVAFSVNHLLGDPMANVAMAYGSSIASHG

    ) of Human YIF1A (NP_065203).

  • Positive control

    • Jurkat cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab136627 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa.

Target

Images

  • Anti-YIF1A antibody - N-terminal (ab136627) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Predicted band size: 32 kDa

References

ab136627 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab136627.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up