Overview

  • Product name

  • Description

    Rabbit polyclonal to YIPF3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human YIPF3 aa 2-148.
    Sequence:

    ATTAAPAGGARNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGSSFEDMG ELHQRLREEEVDADAADAAAAEEEDGEFLGMKGFKGQLSRQVADQMWQAG KRQASRAFSLYANIDILRPYFDVEPAQVRSRLLESMIPIKMVNFPQK


    Database link: Q9GZM5

  • Positive control

    • WB: Mouse heart, liver, brain and stomach lysates. IHC-P: Human colon cancer tissue. ICC/IF: PC-3 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223505 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 39 kDa (predicted molecular weight: 38 kDa).
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    May play a role in hematopoiesis.
  • Tissue specificity

    Expressed by nucleated hematopoietic cells (at protein level).
  • Sequence similarities

    Belongs to the YIP1 family.
  • Developmental stage

    Expressed in fetal liver (at protein level). Expressed in embryonic hematopoiesis sites.
  • Post-translational
    modifications

    Not glycosylated.
  • Cellular localization

    Cell membrane. Cytoplasm. Localization to the cytoplasm or to the cell membrane is developmentally and ontogenetically regulated.
  • Information by UniProt
  • Database links

  • Alternative names

    • C6orf109 antibody
    • dJ337H4.3 antibody
    • FinGER3 antibody
    • Killer lineage protein 1 antibody
    • KLIP1 antibody
    • Natural killer cell-specific antigen KLIP1 antibody
    • Protein YIPF3 antibody
    • Yip1 domain family member 3 antibody
    • YIP1 family member 3 antibody
    • Yipf3 antibody
    • YIPF3_HUMAN antibody
    see all

Images

  • All lanes : Anti-YIPF3 antibody (ab223505) at 1/500 dilution

    Lane 1 : Mouse heart lysate
    Lane 2 : Mouse liver lysate
    Lane 3 : Mouse brain lysate
    Lane 4 : Mouse stomach lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 38 kDa
    Observed band size: 39 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human colon cancer tissue stained for YIPF3 using ab223505 at 1/100 dilution in immunohistochemical analysis.

  • PC-3 (human prostate adenocarcinoma cell line) cells stained for YIPF3 (green) using ab223505 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

References

ab223505 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223505.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up