Overview

  • Product name

    Anti-YIPF5 antibody
  • Description

    Rabbit polyclonal to YIPF5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment (proprietary-tag) corresponding to Human YIPF5 aa 6-94.
    Sequence:

    NLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDM MQPQQPYTGQIYQPTQAYTPASPQPFYGNNFEDEPPLLE


    Database link: Q969M3

  • Positive control

    • U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220061 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Plays a role in transport between endoplasmic reticulum and Golgi.
  • Tissue specificity

    Ubiquitously expressed. Highly expressed in coronary smooth muscles.
  • Sequence similarities

    Belongs to the YIP1 family.
  • Cellular localization

    Endoplasmic reticulum membrane. Golgi apparatus > Golgi stack membrane. Cytoplasmic vesicle > COPII-coated vesicle. Enriched at the endoplasmic reticulum exit sites. Incorporated into COPII coated vesicles.
  • Information by UniProt
  • Database links

  • Alternative names

    • FinGER5 antibody
    • Five pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5 antibody
    • Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5 antibody
    • Golgi membrane protein SB140 antibody
    • Protein YIPF5 antibody
    • SB140 antibody
    • SMAP 5 antibody
    • SMAP-5 antibody
    • SMAP5 antibody
    • Smooth muscle cell associated protein 5 antibody
    • Smooth muscle cell-associated protein 5 antibody
    • Yip1 domain family member 5 antibody
    • YIP1 family member 5 antibody
    • YIP1A antibody
    • yipf5 antibody
    • YIPF5_HUMAN antibody
    • YPT interacting protein 1 A antibody
    • YPT-interacting protein 1 A antibody
    see all

Images

  • Immunofluorescent analysis of paraformaldehyde-fixed, Triton X-100 permeabilized U-2 OS cells labeling YIPF5 with ab220061 at 4 μg/ml dilution showing localization to nucleoplasm and vesicles (green).

References

ab220061 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220061.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up