Overview

  • Product name

  • Description

    Rabbit polyclonal to YKT6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human YKT6 aa 10-195.
    Sequence:

    YKGEAKVVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVERSSKGTRASV KEQDYLCHVYVRNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRID WPVGSPATIHYPALDGHLSRYQNPREADPMTKVQAELDETKIILHNTMES LLERGEKLDDLVSKSEVLGTQSKAFYKTARKQNSCC


    Database link: O15498-1

  • Positive control

    • WB: A549 whole cell lysate. IHC-P: Human adrenal gland tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236583 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 22 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Vesicular soluble NSF attachment protein receptor (v-SNARE) mediating vesicle docking and fusion to a specific acceptor cellular compartment. Functions in endoplasmic reticulum to Golgi transport; as part of a SNARE complex composed of GOSR1, GOSR2 and STX5. Functions in early/recycling endosome to TGN transport; as part of a SNARE complex composed of BET1L, GOSR1 and STX5. Has a S-palmitoyl transferase activity.
  • Sequence similarities

    Belongs to the synaptobrevin family.
    Contains 1 longin domain.
    Contains 1 v-SNARE coiled-coil homology domain.
  • Domain

    The longin domain regulates palmitoylation and membrane targeting.
  • Post-translational
    modifications

    Palmitoylated; catalyzes its own palmitoylation. Palmitoylation is required for Golgi targeting.
    Farnesylation is required for Golgi targeting.
  • Cellular localization

    Cytoplasm > cytosol. Cytoplasmic vesicle membrane. Golgi apparatus membrane. Probably cycles through vesicles between Golgi and endosomes.
  • Information by UniProt
  • Database links

  • Alternative names

    • R SNARE antibody
    • SNARE protein Ykt6 antibody
    • Synaptobrevin homolog YKT6 antibody
    • YKT 6 antibody
    • YKT6 antibody
    • YKT6 S. cerevisiae homolog of antibody
    • YKT6 v SNARE homolog antibody
    • YKT6 v SNARE protein antibody
    • YKT6_HUMAN antibody
    see all

Images

  • Anti-YKT6 antibody (ab236583) at 1/500 dilution + A549 (Human lung carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 22 kDa

  • Paraffin-embedded human adrenal gland tissue stained for YKT6 with ab236583 at 1/100 dilution in immunohistochemical analysis.

References

ab236583 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236583.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up