Overview

  • Product name

    Anti-YLPM1/Zap antibody
  • Description

    Rabbit polyclonal to YLPM1/Zap
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human YLPM1/Zap aa 1170-1264.
    Sequence:

    RDRGELRIREYPERGDTWREKRDYVPDRMDWERERLSDRWYPSDVDRHSP MAEHMPSSHHSSEMMGSDASLDSDQGLGGVMVLSQRQHEIILKA

  • Positive control

    • Human cerebral cortex tissue
  • General notes

    The antibody solution should be gently mixed before use.

     This product was previously labelled as YLPM1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab151016 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

Target

Images

  • Immunofluorescent staining of Human cell line A-431 shows positivity in nucleus but not nucleoli and cytoplasm. Recommended concentration of ab151016 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human cerebral cortex tissue labelling YLPM1/Zap with ab151016 at 1/1000 dilution

References

ab151016 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (K562, NOMO-1, 293T)
Gel Running Conditions
Reduced Denaturing (Tris/Glycine)
Loading amount
20 µg
Specification
K562, NOMO-1, 293T
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C

Abcam user community

Verified customer

Submitted Feb 06 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up