Overview

  • Product name

  • Description

    Rabbit polyclonal to YME1L1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human YME1L1 aa 558-654.
    Sequence:

    AVDGKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTITAYHESGHAIIA YYTKDAMPINKATIMPRGPTLGHVSLLPENDRWNETRAQLLAQMDVS


    Database link: Q96TA2

  • Positive control

    • IHC-P: Human heart muscle tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab244533 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Putative ATP-dependent protease which plays a role in mitochondrial protein metabolism. Ensures cell proliferation, maintains normal cristae morphology and complex I respiration activity, promotes antiapoptotic activity and protects mitochondria from the accumulation of oxidatively damaged membrane proteins. Requires to control the accumulation of nonassembled respiratory chain subunits (NDUFB6, OX4 and ND1). Seems to act in the processing of OPA1.
  • Tissue specificity

    High expression in cardiac and skeletal muscle mitochondria.
  • Sequence similarities

    In the N-terminal section; belongs to the AAA ATPase family.
    In the C-terminal section; belongs to the peptidase M41 family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATP dependent metalloprotease FtsH1 homolog antibody
    • ATP-dependent metalloprotease FtsH1 antibody
    • ATP-dependent metalloprotease YME1L1 antibody
    • ATP-dependent zinc metalloprotease YME1L1 antibody
    • FTSH1 antibody
    • Meg-4 antibody
    • MEG4 antibody
    • PAMP antibody
    • Presenilin-associated metalloprotease antibody
    • UNQ1868/PRO4304 antibody
    • YME1 like 1 antibody
    • YME1-like protein 1 antibody
    • YME1L antibody
    • Yme1l1 antibody
    • YMEL1_HUMAN antibody
    see all

Images

  • Paraffin-embedded human heart muscle tissue stained for YME1L1 using ab244533 at 1/500 dilution in immunohistochemical analysis.
  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for YME1L1 (green) using ab244533 at 4 μg/ml in ICC/IF.

References

ab244533 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244533.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up