Overview

  • Product name

    Anti-YOD1 antibody - N-terminal
    See all YOD1 primary antibodies
  • Description

    Rabbit polyclonal to YOD1 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide within Mouse YOD1 aa 21-70 (N terminal). The exact sequence is proprietary.
    Sequence:

    VPQSEAGTKAGPAGGRPADTMWRVRCKAKGGTHLLQGLSSRTRLRELQGQ


    Database link: Q8CB27

  • Positive control

    • Mouse spleen lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab178979 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 38 kDa.

Target

  • Function

    Hydrolase that can remove conjugated ubiquitin from proteins and participates in endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins. May act by triming the ubiquitin chain on the associated substrate to facilitate their threading through the VCP/p97 pore. Ubiquitin moieties on substrates may present a steric impediment to the threading process when the substrate is transferred to the VCP pore and threaded through VCP's axial channel. Mediates deubiquitination of both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. Able to cleave both polyubiquitin and di-ubiquitin.
  • Sequence similarities

    Contains 1 C2H2-type zinc finger.
    Contains 1 OTU domain.
  • Domain

    The UBAX-like region mediates the interaction with VCP. According to PubMed:19818707, it corresponds to a UBX domain, which is a hallmark for VCP-associated proteins. However, no canonical UBX is detected by prediction tools such as Pfam or PROSITE.
  • Information by UniProt
  • Database links

  • Alternative names

    • DUBA-8 antibody
    • DUBA8 antibody
    • HIN-7 antibody
    • HIV-1-induced protease 7 antibody
    • HsHIN7 antibody
    • OTU domain containing 2 antibody
    • OTU domain-containing protein 2 antibody
    • OTU1_HUMAN antibody
    • OTUD2 antibody
    • PRO0907 antibody
    • RP11-164O23.1 antibody
    • Ubiquitin thioesterase OTU1 antibody
    • yod1 antibody
    • YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae) antibody
    • YOD1 OTU deubiquinating enzyme 1 homolog (yeast) antibody
    • YOD1 OTU deubiquinating enzyme 1, S. cerevisiae, homolog of antibody
    see all

Images

  • Anti-YOD1 antibody - N-terminal (ab178979) at 1 µg/ml + Mouse spleen lysate

    Predicted band size: 38 kDa

References

ab178979 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Loading amount
50 µg
Gel Running Conditions
Reduced Denaturing (4-12% Bis-Tris)
Sample
Human Cell lysate - whole cell (HCT116, RPE-1, 293T)
Specification
HCT116, RPE-1, 293T
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 21°C

Dr. Michal Simicek

Verified customer

Submitted Mar 05 2014

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up