Overview

  • Product name

    Anti-YopM antibody
  • Description

    Rabbit polyclonal to YopM
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Recombinant fragment
    Predicted to work with: Yersinia pestis
  • Immunogen

    Recombinant full length protein corresponding to Yersinia pestis YopM aa 1-409.
    Sequence:

    MFINPRNVSNTFLQEPLRHSSNLTEMPVEAENVKSKTEYYNAWSEWERNA PPGNGEQREMAVSRLRDCLDRQAHELELNNLGLSSLPELPPHLESLVASC NSLTELPELPQSLKSLLVDNNNLKALSDLPPLLEYLGVSNNQLEKLPELQ NSSFLKIIDVDNNSLKKLPDLPPSLEFIAAGNNQLEELPELQNLPFLTAI YADNNSLKKLPDLPLSLESIVAGNNILEELPELQNLPFLTTIYADNNLLK TLPDLPPSLEALNVRDNYLTDLPELPQSLTFLDVSENIFSGLSELPPNLY YLNASSNEIRSLCDLPPSLEELNVSNNKLIELPALPPRLERLIASFNHLA EVPELPQNLKQLHVEYNPLREFPDIPESVEDLRMNSERVVDPYEFAHETT DKLEDDVFE


    Database link: P17778

  • Positive control

    • WB: Recombinant protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab225950 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.

Images

  • All lanes : Anti-YopM antibody (ab225950) at 1/500 dilution

    Lane 1 : Recombinant protein 80 ng
    Lane 2 : Recombinant protein 40 ng
    Lane 3 : Recombinant protein 20 ng
    Lane 4 : Recombinant protein 10 ng

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Developed using the ECL technique.

References

ab225950 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225950.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up