Overview

  • Product name

    Anti-YY1AP1 antibody
  • Description

    Rabbit polyclonal to YY1AP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human YY1AP1 aa 83-215.
    Sequence:

    MEDDGPEEEERVAEPQANFNTPQALRFEELLANLLNEQHQIAKELFEQLK MKKPSAKQQKEVEKVKPQCKEVHQTLILDPAQRKRLQQQMQQHVQLLTQI HLLATCNPNLNPEASSTRICLKELGTFAQSSIA


    Database link: Q9H869

  • Positive control

    • IHC-P: Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224067 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Enhances transcription activation by YY1. May play a role in cell cycle regulation.
  • Tissue specificity

    Ubiquitous. Detected in small intestine, skeletal muscle, lung, pancreas, brain, stomach, spleen, colon and heart. Detected at very low levels in healthy liver. Highly expressed in most liver carcinomas.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ10875 antibody
    • FLJ13914 antibody
    • GRNG antibody
    • HCCA1 antibody
    • HCCA2 antibody
    • Hepatocellular carcinoma susceptibility protein antibody
    • Hepatocellular carcinoma-associated protein 2 antibody
    • OTTHUMP00000033475 antibody
    • OTTHUMP00000033476 antibody
    • OTTHUMP00000200831 antibody
    • OTTHUMP00000200832 antibody
    • OTTHUMP00000200833 antibody
    • OTTHUMP00000200836 antibody
    • YAP antibody
    • YY1-associated protein 1 antibody
    • YY1AP antibody
    • YY1AP1 antibody
    • YYAP1_HUMAN antibody
    see all

Images

  • Paraffin embedded human kidney tissue stained for YY1AP1 using ab224067 at 1/20 dilution in immunohistochemical analysis.

References

ab224067 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224067.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up