Overview

  • Product name

    Anti-YY2 antibody
  • Description

    Rabbit polyclonal to YY2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human YY2 aa 96-179.
    Sequence:

    QLGNDLEDQLALPDSIEDEHFQMTLASLSASAASTSTSTQSRSKKPSKKP SGKSATSTEANPAGSSSSLGTRKWEQKQMQVKTL


    Database link: O15391

  • Positive control

    • HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220099 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Functions as a multifunctional transcription factor that may exhibit positive and negative control on a large number of genes. May antagonize YY1 and function in development and differentiation.
  • Tissue specificity

    Expressed in kidney, liver, spleen and testis but not in colon.
  • Sequence similarities

    Belongs to the YY transcription factor family.
    Contains 4 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Transcription factor yin yang 2 antibody
    • Transcription factor YY2 antibody
    • TYY2_HUMAN antibody
    • Yin and yang 2 antibody
    • YY-2 antibody
    • Yy2 antibody
    • YY2 transcription factor antibody
    • Zinc finger protein 631 antibody
    • ZNF631 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized HeLa cells labeling YY2 with ab220099 at 4 µg/ml (green).  

References

ab220099 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220099.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up