Overview

  • Product name
    Anti-Z DNA binding protein antibody
    See all Z DNA binding protein primary antibodies
  • Description
    Rabbit polyclonal to Z DNA binding protein
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human Z DNA binding protein aa 144-193 (internal sequence). The exact sequence is proprietary.
    Sequence:

    LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNG


    Database link: Q9H171

  • Positive control
    • Jurkat cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab32927 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/312500.
WB Use a concentration of 5 µg/ml. Detects a band of approximately 46 kDa (predicted molecular weight: 46 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    May play a role in host defense against tumors and pathogens. Binds Z-DNA.
  • Tissue specificity
    Highly expressed in lymphatic tissues including lymph node, leukocytes, tonsil, bone marrow and spleen. Expressed to a lesser extent in thymus, lung and liver.
  • Sequence similarities
    Contains 2 DRADA repeats.
  • Information by UniProt
  • Database links
  • Alternative names
    • C20orf183 antibody
    • DAI antibody
    • DLM 1 antibody
    • DLM1 antibody
    • DNA-dependent activator of interferon regulatory factors antibody
    • DNA-dependent activator of IRFs antibody
    • OTTHUMP00000031373 antibody
    • OTTHUMP00000174290 antibody
    • OTTHUMP00000237854 antibody
    • Tumor stroma and activated macrophage protein DLM 1 antibody
    • Tumor stroma and activated macrophage protein DLM-1 antibody
    • Z-DNA-binding protein 1 antibody
    • ZBP 1 antibody
    • Zbp1 antibody
    • ZBP1_HUMAN antibody
    • ZDBP1 antibody
    see all

Images

  • Anti-Z DNA binding protein antibody (ab32927) at 5 µg/ml + Jurkat cell lysate

    Secondary
    HRP conjugated anti-Rabbit IgG
    1: 50,000 - 100,000

    Predicted band size: 46 kDa
    Observed band size: 46 kDa

References

ab32927 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Question
Answer

Thank you for confirming these details and for your cooperation. The details provided enable us to closely monitor the quality of our products. I am sorry this product did not perform as stated on the datasheet and for the inconvenience this has caused. As requested, I have issued a free of charge replacement with the order number ***** for the monoclonal antibody, ab118361. To check the status of the order please contact our Customer Service team and reference this number. Please note that this free of charge replacement vial is also covered by our Abpromise guarantee. Should you still be experiencing difficulties, or if you have any further questions, please do not hesitate to let us know. I wish you the best of luck with your research.  

Read More

Answer

Thank you for your enquiry and your interest in our products. I have quickly checked our on-line catalogue and currently the only antibody is available against this target is ab32927 which has been characterised for cross-reaction with human only. This antibody is raised against non-phosphorylated epitope(s) so it is very unlikely that it recognizes any phosphorylated form. All species cross-reactivity information is stated on Abcam product datasheets, and these are updated as soon as any new information is brought to our attention. If you decide to go ahead and purchase this product, we encourage you to submit an Abreview via the online product datasheet. We always encourage customers to send their results back to us, whether positive or negative, and we make all product information available to researchers. To find out more about our Abreview system, please see the following URL: https://www.abcam.com/abreviews I hope this information helps, please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up