Overview

  • Product name

  • Description

    Mouse polyclonal to Z-protein
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human Z-protein aa 1-238.
    Sequence:

    MADPDPRYPRSSIEDDFNYGSSVASATVHIRMAFLRKVYSILSLQVLLTT VTSTVFLYFESVRTFVHESPALILLFALGSLGLIFALILNRHKYPLNLYL LFGFTLLEALTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFS KFGAGLFALLWILCLSGFLKFFFYSEIMELVLAAAGALLFCGFIIYDTHS LMHKLSPEEYVLAAISLYLDIINLFLHLLRFLEAVNKK

  • Positive control

    • Z-protein transfected 293T cell lysate.
  • General notes

    Previously labelled as TMBIM4.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer

    pH: 7.20
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab169461 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 27 kDa.

Target

  • Sequence similarities

    Belongs to the BI1 family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CGI-119 antibody
    • GAAP antibody
    • Golgi anti apoptotic protein antibody
    • LFG4 antibody
    • Protein lifeguard 4 antibody
    • Protein S1R antibody
    • TMBI4_HUMAN antibody
    • TMBIM4 antibody
    • Transmembrane BAX inhibitor motif-containing protein 4 antibody
    • Z-protein antibody
    • ZPRO antibody
    see all

Images

  • All lanes : Anti-Z-protein antibody (ab169461) at 1 µg/ml

    Lane 1 : Z-protein transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 27 kDa

References

This product has been referenced in:

  • Ohana J  et al. dTCApFs, a derivative of a novel human hormone peptide, induces apoptosis in cancer cells through a mechanism involving loss of Golgi function. Mol Clin Oncol 7:991-999 (2017). Read more (PubMed: 29285362) »
See 1 Publication for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Western blot
Sample
Human Cell lysate - whole cell (N87 cell line)
Gel Running Conditions
Non-reduced Denaturing (4-20% Tris Glycin gel)
Loading amount
1e+006 cells
Specification
N87 cell line
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C

Abcam user community

Verified customer

Submitted Jul 20 2016

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (Panc1 Pancreatic Cancer line)
Permeabilization
Yes - 0.25% TritonX-100 in PBS
Specification
Panc1 Pancreatic Cancer line
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 20°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Feb 03 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up