For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    zap70-antibody-spm362-ab233985.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Adaptive Immunity T Cells CD
Share by email

Anti-ZAP70 antibody [SPM362] (ab233985)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZAP70 antibody [SPM362] (ab233985)

    Key features and details

    • Mouse monoclonal [SPM362] to ZAP70
    • Suitable for: IHC-P
    • Reacts with: Human
    • Isotype: IgG2a

    You may also be interested in

    Secondary
    Product image
    Goat Anti-Mouse IgG H&L (HRP) (ab205719)

    View more associated products

    Overview

    • Product name

      Anti-ZAP70 antibody [SPM362]
      See all ZAP70 primary antibodies
    • Description

      Mouse monoclonal [SPM362] to ZAP70
    • Host species

      Mouse
    • Tested applications

      Suitable for: IHC-Pmore details
    • Species reactivity

      Reacts with: Human
      Predicted to work with: Mouse
    • Immunogen

      Recombinant fragment corresponding to Human ZAP70 aa 1-254. Encompassing SH2 domains of human ZAP70.
      Sequence:

      MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSL VHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRK PCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVE KLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYAL SLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCL KEAC


      Database link: P43403
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • IHC-P: Human tonsil tissue.
    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      Preservative: 0.05% Sodium azide
      Constituents: PBS, 0.05% BSA
    • Concentration information loading...
    • Purity

      Protein A/G purified
    • Purification notes

      Purified from Bioreactor Concentrate by Protein A/G.
    • Clonality

      Monoclonal
    • Clone number

      SPM362
    • Isotype

      IgG2a
    • Light chain type

      kappa
    • Research areas

      • Immunology
      • Adaptive Immunity
      • T Cells
      • CD
      • Tags & Cell Markers
      • Cell Type Markers
      • Tumor Associated
      • Signal Transduction
      • Protein Phosphorylation
      • Tyrosine Kinases
      • Other

    Associated products

    • Compatible Secondaries

      • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
      • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
    • Isotype control

      • Mouse IgG2a, kappa monoclonal [MG2a-53] - Isotype control (ab18415)
    • Recombinant Protein

      • Recombinant human ZAP70 protein (ab60963)
    • Related Products

      • Recombinant human ZAP70 protein (ab60963)

    Applications

    Our Abpromise guarantee covers the use of ab233985 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

    Incubate with primary antibody for 30 minutes at room temperature.

    Target

    • Function

      Plays a role in T-cell development and lymphocyte activation. Essential for TCR-mediated IL-2 production. Isoform 1 induces TCR-mediated signal transduction, isoform 2 does not.
    • Tissue specificity

      Expressed in T- and natural killer cells.
    • Involvement in disease

      Defects in ZAP70 are the cause of selective T-cell defect (STD) [MIM:176947]. STD is an autosomal recessive form of severe combined immunodeficiency characterized by a selective absence of CD8-type T-cells.
    • Sequence similarities

      Belongs to the protein kinase superfamily. Tyr protein kinase family. SYK/ZAP-70 subfamily.
      Contains 1 protein kinase domain.
      Contains 2 SH2 domains.
    • Domain

      The SH2 domains bind to the phosphorylated tyrosine-based activation motif (TAM) of CD3Z and the non-canonical phosphorylated tyrosine-based activation motif (TAM) of RHOH.
    • Post-translational
      modifications

      Phosphorylated on tyrosine residues upon T-cell antigen receptor (TCR) stimulation. Tyr-319 phosphorylation is essential for full activity.
    • Cellular localization

      Cytoplasm. Cell membrane. After antigen stimulation, isoform 1 concentrates at the immunological synapse and isoform 2 remains cytoplasmic. Co-localizes together with RHOH in the immunological synapse. RHOH is required for its proper localization to the cell membrane and cytoskeleton fractions in the thymocytes.
    • Target information above from: UniProt accession P43403 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 7535 Human
      • Entrez Gene: 22637 Mouse
      • Omim: 176947 Human
      • SwissProt: P43403 Human
      • SwissProt: P43404 Mouse
      • Unigene: 234569 Human
      • Unigene: 8038 Mouse
      • Alternative names

        • 70 kDa zeta associated protein antibody
        • 70 kDa zeta-associated protein antibody
        • EC 2.7.10.2 antibody
        • FLJ17670 antibody
        • FLJ17679 antibody
        • Selective T cell defect antibody
        • SRK antibody
        • STD antibody
        • Syk related tyrosine kinase antibody
        • Syk-related tyrosine kinase antibody
        • Truncated ZAP kinase antibody
        • Tyrosine protein kinase ZAP70 antibody
        • Tyrosine-protein kinase ZAP-70 antibody
        • TZK antibody
        • ZAP 70 antibody
        • ZAP70 antibody
        • ZAP70_HUMAN antibody
        • Zeta chain associated protein kinase 70kD antibody
        • Zeta chain associated protein kinase 70kDa antibody
        • Zeta chain associated protein kinase 70kDa isoform 1 antibody
        • Zeta chain associated protein kinase 70kDa isoform 2 antibody
        • Zeta chain of T cell receptor associated protein kinase 70 antibody
        • Zeta chain TCR associated protein kinase 70kD antibody
        • Zeta chain TCR associated protein kinase 70kDa antibody
        see all

      Images

      • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZAP70 antibody [SPM362] (ab233985)
        Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZAP70 antibody [SPM362] (ab233985)

        Formalin-fixed, paraffin-embedded human tonsil tissue stained for ZAP70 using ab233985 at 1 μg/ml in immunohistochemical analysis.

      Protocols

      To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

      Click here to view the general protocols

      Datasheets and documents

      • Datasheet
    • References (0)

      Publishing research using ab233985? Please let us know so that we can cite the reference in this datasheet.

      ab233985 has not yet been referenced specifically in any publications.

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      There are currently no Customer reviews or Questions for ab233985.
      Please use the links above to contact us or submit feedback about this product.

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2021 Abcam plc. All rights reserved.