Overview

  • Product name

    Anti-ZBRK1 antibody - C-terminal
    See all ZBRK1 primary antibodies
  • Description

    Rabbit polyclonal to ZBRK1 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZBRK1 aa 233-532 (C terminal).
    Sequence:

    PHRCSLCEKAFSRKFMLTEHQRTHTGEKPYECPECGKAFLKKSRLNIHQK THTGEKPYICSECGKGFIQKGNLIVHQRIHTGEKPYICNECGKGFIQKTC LIAHQRFHTGKTPFVCSECGKSCSQKSGLIKHQRIHTGEKPFECSECGKA FSTKQKLIVHQRTHTGERPYGCNECGKAFAYMSCLVKHKRIHTREKQEAA KVENPPAERHSSLHTSDVMQEKNSANGATTQVPSVAPQTSLNISGLLANR NVVLVGQPVVRCAASGDNRGFAQDRNLVNAVNVVVPSVINYVLFYVTENP


    Database link: Q9GZX5

  • Positive control

    • IHC-P: Human testis and prostate cancer tissues.
  • General notes

    Previously labelled as ZNF350.

Properties

Applications

Our Abpromise guarantee covers the use of ab225939 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Transcriptional repressor. Binds to a specific sequence, 5'-GGGxxxCAGxxxTTT-3', within GADD45 intron 3.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 8 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization

    Nucleus matrix. Associated with the nuclear matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • KRAB zinc finger protein ZFQR antibody
    • ZBRK1 antibody
    • ZFQR antibody
    • Zinc finger and BRCA1 interacting protein with a KRAB domain 1 antibody
    • Zinc finger and BRCA1-interacting protein with a KRAB domain 1 antibody
    • Zinc finger protein 350 antibody
    • Zinc finger protein ZBRK1 antibody
    • ZN350_HUMAN antibody
    • ZNF350 antibody
    see all

Images

  • Paraffin-embedded human prostate cancer tissue stained for ZBRK1 using ab225939 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for ZBRK1 using ab225939 at 1/100 dilution in immunohistochemical analysis.

References

ab225939 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225939.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up