Overview

  • Product name

    Anti-ZBTB40 antibody - C-terminal
    See all ZBTB40 primary antibodies
  • Description

    Rabbit polyclonal to ZBTB40 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human ZBTB40 aa 951-1239 (C terminal).
    Sequence:

    DCKKCRMSFPTLQDHRKHIHEVHSKEYHPCPTCGKIFSAPSMLERHMVTH VGGKPFSCGICNKAYQQLSGLWYHNRTHHPDVFAAQNHRSSKFSSLQCSS CDKTFPNTIEHKKHIKAEHADMKFHECDQCKELFPTPALLQVHVKCQHSG SQPFRCLYCAATFRFPGALQHHVTTEHFKQSETTFPCELCGELFTSQAQL DSHLESEHPKVMSTETQAAASQMAQVIQTPEPVAPTEQVITLEETQLAGS QVFVTLPDSQASQASSELVAVTVEDLLDGTVTLICGEAK


    Database link: Q9NUA8

  • Positive control

    • U2OS cell lysate, Mouse embrio fibroblasts cell lysate and INS1 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab190185 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 138 kDa.

Target

  • Function

    May be involved in transcriptional regulation.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 1 BTB (POZ) domain.
    Contains 12 C2H2-type zinc fingers.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • BC059177 antibody
    • C230087D24 antibody
    • Gm571 antibody
    • KIAA0478 antibody
    • MGC133098 antibody
    • MGC62412 antibody
    • mKIAA0478 antibody
    • RGD1309866 antibody
    • RP23 95O23.1 antibody
    • ZBT40_HUMAN antibody
    • ZBTB40 antibody
    • Zinc finger and BTB domain containing 40 antibody
    • Zinc finger and BTB domain containing protein 40 antibody
    • Zinc finger and BTB domain-containing protein 40 antibody
    • ZNF923 antibody
    see all

Images

  • All lanes : Anti-ZBTB40 antibody - C-terminal (ab190185) at 1/2000 dilution

    Lane 1 : U2OS cell lysate
    Lane 2 : U2OS cells transfected with ZBTB40 siRNA
    Lane 3 : Mouse embrio fibroblasts (MEFs) cell lysate
    Lane 4 : INS1 cell lysate

    Lysates/proteins at 40 µg per lane.

    Predicted band size: 138 kDa

References

ab190185 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190185.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up