Overview

  • Product name

  • Description

    Rabbit polyclonal to ZBTB43
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZBTB43 aa 286-345.
    Sequence:

    GVEEDFHIGEKKVEAEFDEQADESNYDEQVDFYGSSMEEFSGERSDGNLI GHRQEAALAAGYSENIEMVTGIKEEASHLGFSATDKLYPCQCGKSFTHKS QRDRHMSMHLGL


    Database link: O43298

  • Positive control

    • IHC-P: Human testis tissue. ICC/IF: U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224387 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May be involved in transcriptional regulation.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 1 BTB (POZ) domain.
    Contains 3 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • RP11489N222 antibody
    • ZBT43_HUMAN antibody
    • ZBTB22B antibody
    • ZBTB43 antibody
    • Zinc Finger And BTB Domain Containing 43 antibody
    • Zinc finger and BTB domain-containing protein 22B antibody
    • Zinc finger and BTB domain-containing protein 43 antibody
    • Zinc finger protein 297B antibody
    • ZnF-x antibody
    • ZNF297B antibody
    • ZNFX antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for ZBTB43 using ab224387 at 1/20 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for ZBTB43 (green) using ab224387 at 4 µg/ml in ICC/IF.

References

ab224387 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (testis)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: citric aid
Permeabilization
Yes - 0.2%triton x-100
Specification
testis
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 4°C
Fixative
Paraformaldehyde

HONGJUAN HE

Verified customer

Submitted Apr 29 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up