Overview

  • Product name

  • Description

    Rabbit polyclonal to ZBTB46
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human ZBTB46 aa 174-362.
    Sequence:

    RTSPANSSGDSAIASCHDGGSSYGKEDQEPKADGPDDVSSQPLWPGDVGY GPLRIKEEQVSPSQYGGSELPSAKDGAVQNSFSEQSAGDAWQPTGRRKNR KNKETVRHITQQVEDDSRASSPVPSFLPTSGWPFSSRDSNADLSVTEASS SDSRGERAELYAQVEEGLLGGEASYLGPPLTPEKDDALH


    Database link: Q86UZ6

  • Positive control

    • WB: HEK-293T and SH-SY5Y cell lysates; Mouse heart, liver and kidney tissue lysates. IHC-P: Human brain and rectum tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222830 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 64 kDa (predicted molecular weight: 64 kDa).

Target

  • Relevance

    ZBTB46 may be involved in transcriptional regulation. It contains one BTB (POZ) domain and two C2H2 type zinc fingers.
  • Cellular localization

    Nucleus
  • Database links

  • Alternative names

    • BTB/POZ domain containing protein 4 antibody
    • BTBD4 antibody
    • RINZF antibody
    • Zinc finger and BTB domain containing 46 antibody
    • Zinc finger and BTB domain containing protein 46 antibody
    • Zinc finger protein 340 antibody
    • ZNF340 antibody
    see all

Images

  • All lanes : Anti-ZBTB46 antibody (ab222830) at 1/1000 dilution

    Lane 1 : Mouse heart tissue lysate
    Lane 2 : Mouse liver tissue lysate
    Lane 3 : Mouse kidney tissue lysate
    Lane 4 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 5 : SH-SY5Y (human neuroblastoma cell line from bone marrow) whole cell lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG at 1/10000 dilution

    Predicted band size: 64 kDa
    Observed band size: 64 kDa

  • Paraffin-embedded human brain tissue stained for ZBTB46 using ab222830 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human rectum tissue stained for ZBTB46 using ab222830 at 1/100 dilution in immunohistochemical analysis.

References

ab222830 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222830.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up