Overview

  • Product name

    Anti-ZBTB48 antibody - N-terminal
    See all ZBTB48 primary antibodies
  • Description

    Rabbit polyclonal to ZBTB48 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ZBTB48 aa 1-280 (N terminal).
    Sequence:

    MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHF FQSLYGDGSGGSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAAR ELRVPEAVELCQSFKPKTSVGQAAGGQSGLGPPASQNVNSHVKEPAGLEE EEVSRTLGLVPRDQEPRGSHSPQRPQLHSPAQSEGPSSLCGKLKQALKPC PLEDKKPEDCKVPPRPLEAEGAQLQGGSNEWEVVVQVEDDGDGDYMSEPE AVLTRRKSNVIRKPCAAEPALSAGSLAAEP


    Database link: P10074

  • Positive control

    • WB: HEK-293T, K562, HepG2 and U-251 MG whole cell lysates; Mouse liver tissue lysate. IHC-P: Human spleen and lung tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab225935 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 77 kDa (predicted molecular weight: 77 kDa).

Target

  • Function

    Binds to and regulates the J and/or S elements in MHC II promoter.
  • Tissue specificity

    Detected in adrenal gland and neuroblastoma.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 1 BTB (POZ) domain.
    Contains 11 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 0610011D15Rik antibody
    • AI327031 antibody
    • GLI Kruppel family member HKR3 antibody
    • HKR3 antibody
    • Krueppel related zinc finger protein 3 antibody
    • Krueppel-related zinc finger protein 3 antibody
    • OTTMUSP00000031803 antibody
    • pp9964 antibody
    • Protein HKR3 antibody
    • RP23-445E20.3 antibody
    • ZBT48_HUMAN antibody
    • ZBTB 48 antibody
    • Zbtb48 antibody
    • Zinc finger and BTB domain containing 48 antibody
    • Zinc finger and BTB domain containing protein 48 antibody
    • Zinc finger and BTB domain-containing protein 48 antibody
    • Zinc finger protein 855 antibody
    • ZNF855 antibody
    see all

Images

  • All lanes : Anti-ZBTB48 antibody - N-terminal (ab225935) at 1/1000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : K562 (human chronic myelogenous leukemia cell line from bone marrow ) whole cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 4 : U-251 MG (human brain glioma cell line) whole cell lysate
    Lane 5 : Mouse liver tissue lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/100000 dilution

    Developed using the ECL technique.

    Predicted band size: 77 kDa
    Observed band size: 77 kDa

  • Paraffin-embedded human spleen tissue stained for ZBTB48 using ab225935 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung tissue stained for ZBTB48 using ab225935 at 1/100 dilution in immunohistochemical analysis.

References

ab225935 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225935.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up