Overview

  • Product name

    Anti-ZBTB8OS antibody
  • Description

    Rabbit polyclonal to ZBTB8OS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human ZBTB8OS aa 2-136.
    Sequence:

    AQEEEDVRDYNLTEEQKAIKAKYPPVNRKYEYLDHTADVQLHAWGDTLEE AFEQCAMAMFGYMTDTGTVEPLQTVEVETQGDDLQSLLFHFLDEWLYKFS ADEFFIPRVGRRIFIVQAPSGNRSQSNNIFSNAGL


    Database link: Q8IWT0-2

  • Positive control

    • WB: HL-60 whole cell lysate. IHC-P: Human spleen tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237490 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 16 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Sequence similarities

    Belongs to the archease family.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARCH antibody
    • ARCH_HUMAN antibody
    • ARCH2 antibody
    • Archease (ARCH) antibody
    • Archease like protein antibody
    • MGC62007 antibody
    • OTTHUMP00000036124 antibody
    • Protein archease antibody
    • Protein ZBTB8OS antibody
    • ZBTB8OS antibody
    • Zinc finger and BTB domain containing 8 opposite strand antibody
    • Zinc finger and BTB domain containing opposite strand protein 8 antibody
    • Zinc finger and BTB domain-containing opposite strand protein 8 antibody
    see all

Images

  • Anti-ZBTB8OS antibody (ab237490) at 1/500 dilution + HL-60 (human promyelocytic leukemia cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 16 kDa

  • Paraffin-embedded human spleen tissue stained for ZBTB8OS using ab237490 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for ZBTB8OS (green) using ab237490 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

References

ab237490 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237490.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up