Overview

  • Product name

  • Description

    Rabbit polyclonal to ZCCHC4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human ZCCHC4 aa 90-180.
    Sequence:

    AREAHNRRCQPPLSRTQCVERYLKFIELPLTQRKFCQTCQQLLLPDDWGQ HSEHQVLGNVSITQLRRPSQLLYPLENKKTNAQYLFADRSC


    Database link: Q9H5U6

  • Positive control

    • Human duodenum tissue; U-251MG cell line lysate; Human plasma (IgG/HSA depleted); Human liver and tonsil tissue lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab209901 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May be a methyltransferase.
  • Sequence similarities

    Contains 1 CCHC-type zinc finger.
    Contains 1 DHHC-type zinc finger.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4930449I23Rik antibody
    • DHHC domain containing zinc finger protein antibody
    • HSPC052 antibody
    • MGC21108 antibody
    • OTTMUSP00000027189 antibody
    • zcchc4 antibody
    • ZCHC4_HUMAN antibody
    • ZGRF4 antibody
    • Zinc finger CCHC domain containing protein 4 antibody
    • Zinc finger CCHC domain-containing protein 4 antibody
    • Zinc finger CCHC type containing 4 antibody
    • Zinc finger GRF type containing 4 antibody
    • Zinc finger, CCHC domain containing 4 antibody
    see all

Images

  • All lanes : Anti-ZCCHC4 antibody (ab209901) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251MG cell lysate
    Lane 3 : Human plasma (IgG/HSA depleted)
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate
  • Immunohistochemical analysis of paraffin-embedded Human duodenum tissue labeling ZCCHC4 with ab209901 at 1/20 dilution.

References

ab209901 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (HeLa)
Gel Running Conditions
Reduced Denaturing (8% gel)
Loading amount
25 µg
Specification
HeLa
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 3% · Temperature: 25°C

Dr. Honghui Ma

Verified customer

Submitted Mar 20 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up