Overview

  • Product name

  • Description

    Rabbit polyclonal to ZCCHC6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZCCHC6 aa 605-728.
    Sequence:

    VARTLNSQPVFEYILHCLRTTYKYFALPHKITKSSLLKPLNAITCISEHS KEVINHHPDVQTKDDKLKNSVLAQGPGATSSAANTCKVQPLTLKETAESF GSPPKEEMGNEHISVHPENSDCIQ


    Database link: Q5VYS8

  • Positive control

    • IHC-P: Human duodenum tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224112 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    ZCCHC6 contains 3 CCHC-type zinc fingers.
  • Database links

  • Alternative names

    • KIAA1711 antibody
    • MGC38585 antibody
    • PAP associated domain containing 6 antibody
    • PAPD6 antibody
    • Zinc finger CCHC domain containing 6 antibody
    see all

Images

  • Paraffin-embedded human duodenum tissue stained for ZCCHC6 using ab224112 at 1/20 dilution in immunohistochemical analysis.

References

ab224112 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224112.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up