Overview

  • Product name

    Anti-ZDHHC1 antibody
  • Description

    Rabbit polyclonal to ZDHHC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human ZDHHC1 aa 283-389.
    Sequence:

    VQHRPPQEAKGVHRELESCPPKMRPIQEMEFYMRTFRHMRPEPPGQAGPA AVNAKHSRPASPDPTPGRRDCAGPPVQVEWDRKKPLPWRSPLLLLAMWGP QAPPCLC


    Database link: Q8WTX9

  • Positive control

    • WB: Mouse spleen tissue lysate. IHC-P: Human prostate cancer tissue. ICC/IF: A549 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223042 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 55 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Tissue specificity

    Expressed at high levels in fetal lung, kidney and heart. Expressed at lower levels in adult pancreas and lung.
  • Sequence similarities

    Belongs to the DHHC palmitoyltransferase family.
    Contains 1 DHHC-type zinc finger.
  • Domain

    The DHHC domain is required for palmitoyltransferase activity.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C16orf1 antibody
    • DHHC domain containing cysteine rich protein antibody
    • DHHC domain-containing cysteine-rich protein 1 antibody
    • DHHC-1 antibody
    • HSU90653 antibody
    • Probable palmitoyltransferase ZDHHC1 antibody
    • ZDHC1_HUMAN antibody
    • Zdhhc1 antibody
    • Zinc finger DHHC domain containing 1 antibody
    • Zinc finger DHHC domain-containing protein 1 antibody
    • Zinc finger DHHC type containing 1 antibody
    • Zinc finger protein 377 antibody
    • ZNF377 antibody
    see all

Images

  • Anti-ZDHHC1 antibody (ab223042) at 1/1000 dilution + Mouse spleen tissue lysate

    Secondary
    Goat Anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 55 kDa
    Observed band size: 55 kDa

  • Paraffin-embedded human prostate cancer tissue stained for ZDHHC1 using ab223042 at 1/100 dilution in immunohistochemical analysis.

  • A549 (human lung carcinoma cell line) cells stained for ZDHHC1 (green) using ab223042 at 1/100 dilution in ICC/IF. Secondary: Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

References

ab223042 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223042.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up