Overview

  • Product name

  • Description

    Rabbit polyclonal to ZDHHC14
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human ZDHHC14 aa 308-369.
    Sequence:

    FTNCCVALCGPISPSLIDRRGYIQPDTPQPAAPSNGITMYGATQSQSDMC DQDQCIQSTKFV


    Database link: Q8IZN3

  • Positive control

    • ICC/IF: Si-Ha cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221122 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

  • Relevance

    ZDHHC14 belongs to the DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily. It contains 1 DHHC type zinc finger. The function of ZDHHC14 remains unknown.
  • Cellular localization

    Membrane; Multi pass membrane protein.
  • Database links

  • Alternative names

    • DHHC 14 antibody
    • NEW1 domain containing protein antibody
    • NEW1CP antibody
    • Zinc finger DHHC domain containing 14 antibody
    • Zinc finger DHHC domain containing protein 14 antibody
    • zinc finger DHHC type containing 14 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed/Triton X-100 permeabilized Si-Ha cells labeling ZDHHC14 with ab221122 at 4 μg/mL (green).

References

ab221122 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (testis)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: 10mM Sodium Citrate (pH6.0)
Permeabilization
No
Specification
testis
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 25°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Jun 29 2017

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (testis)
Permeabilization
Yes - 0.1% TritonX-100 / PBS
Specification
testis
Blocking step
0.1% tween20, 10% normal donkey serum, 1% BSA-V / PBS as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 25°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Jun 29 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up