Anti-DHHC-15 antibody (ab121203)
Key features and details
- Rabbit polyclonal to DHHC-15
- Suitable for: IHC-P, WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-DHHC-15 antibody -
Description
Rabbit polyclonal to DHHC-15 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human DHHC-15 aa 238-322 (internal sequence).
Sequence:VSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGS SPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQ
-
Positive control
- Human pancreas tissue; Human liver lysate.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab121203 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
|
WB |
1/100 - 1/250.
|
|
ICC/IF | (1) |
Use a concentration of 0.25 - 2 µg/ml.
|
Notes |
---|
IHC-P
1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
WB
1/100 - 1/250. |
ICC/IF
Use a concentration of 0.25 - 2 µg/ml. |
Target
-
Function
Palmitoyltransferase specific for GAP43 and DLG4/PSD95. -
Tissue specificity
Expressed in placenta, liver, lung, kidney, heart and brain. -
Involvement in disease
Defects in ZDHHC15 are the cause of mental retardation X-linked type 91 (MRX91) [MIM:300577]. Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Non-syndromic mental retardation patients do not manifest other clinical signs. -
Sequence similarities
Belongs to the DHHC palmitoyltransferase family.
Contains 1 DHHC-type zinc finger. -
Domain
The DHHC domain is required for palmitoyltransferase activity. -
Post-translational
modificationsAutopalmitoylated. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 158866 Human
- Omim: 300576 Human
- SwissProt: Q96MV8 Human
- Unigene: 253211 Human
-
Alternative names
- DHHC-15 antibody
- Palmitoyltransferase ZDHHC15 antibody
- UNQ1969/PRO4501 antibody
see all
Images
-
Immunofluorescent staining of Human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoplasm. Recommended concentration of ab121203 1-4 µg/ml. Cells treated with PFA/Triton X-100.
-
ab121203 at 1/5 dilution staining DHHC-15 in Paraffin-embedded Human Pancreas tissue by Immunohistochemistry.
-
All lanes : Anti-DHHC-15 antibody (ab121203) at 1/250 dilution
Lane 1 : RT 4 cell lysate
Lane 2 : U 251 MG cell lysate
Lane 3 : A431 cell lysate
Lane 4 : Human Liver cell lysate
Lane 5 : Human tonsil cell lysate
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab121203 has been referenced in 1 publication.
- Shah BS et al. Regulation of dendrite morphology and excitatory synapse formation by zDHHC15. J Cell Sci 132:N/A (2019). PubMed: 31189538