Overview

  • Product name

    Anti-ZDHHC23 antibody
  • Description

    Rabbit polyclonal to ZDHHC23
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Human ZDHHC23 aa 1-409.
    Sequence:

    MTQKGSMKPVKKKKTEEPELEPLCCCEYIDRNGEKNHVATCLCDCQDLDE GCDRWITCKSLQPETCERIMDTISDRLRIPWLRGAKKVNISIIPPLVLLP VFLHVASWHFLLGVVVLTSLPVLALWYYYLTHRRKEQTLFFLSLGLFSLG YMYYVFLQEVVPKGRVGPVQLAVLTCGLFLILLALHRAKKNPGYLSNPAS GDRSLSSSQLECLSRKGQEKTKGFPGADMSGSLNNRTTKDDPKGSSKMPA GSPTKAKEDWCAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESN HQAFILALLIFLLTSVYGITLTLDTICRDRSVFTALFYCPGVYANYSSAL SFTCVWYSVIITAGMAYIFLIQLINISYNVTEREVQQALRQKTGRRLLCG LIVDTGLLG


    Database link: Q8IYP9

  • Positive control

    • WB: Human spleen lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Purity

    Whole antiserum
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224186 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/4000.

Target

Images

  • Anti-ZDHHC23 antibody (ab224186) at 1/4000 dilution + Human spleen lysate

References

ab224186 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224186.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up